>1seiA 1 129 1 137 2e-38
ref|YP_005283.1| SSU ribosomal protein S8P [Thermus thermophilus HB27]
ref|YP_144944.1| 30S ribosomal protein S8 [Thermus
thermophilus HB8] emb|CAA56094.1| ribosomal S8 protein
[Thermus thermophilus] gb|AAS81656.1| SSU ribosomal
protein S8P [Thermus thermophilus HB27] dbj|BAD71501.1|
30S ribosomal protein S8 [Thermus thermophilus HB8]
gb|AAB25287.1| ribosomal protein S8 [Thermus
thermophilus, Peptide, 138 aa] pdb|1PNX|H Chain H,
Crystal Structure Of The Wild Type Ribosome From E.
Coli, 30s Subunit Of 70s Ribosome. This File, 1pnx,
Contains Only Molecules Of The 30s Ribosomal Subunit.
The 50s Subunit Is In The Pdb File 1pny. pdb|1PNS|H
Chain H, Crystal Structure Of A Streptomycin Dependent
Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This
File, 1pns, Contains The 30s Subunit, Two Trnas, And One
Mrna Molecule. The 50s Ribosomal Subunit Is In File
1pnu. pdb|1JGQ|K Chain K, The Path Of Messenger Rna
Through The Ribosome. This File, 1jgq, Contains The 30s
Ribosome Subunit, Three Trna, And Mrna Molecules. 50s
Ribosome Subunit Is In The File 1giy pdb|1JGP|K Chain K,
The Path Of Messenger Rna Through The Ribosome. This
File, 1jgp, Contains The 30s Ribosome Subunit, Three
Trna, And Mrna Molecules. 50s Ribosome Subunit Is In The
File 1giy pdb|1JGO|K Chain K, The Path Of Messenger Rna
Through The Ribosome. This File, 1jgo, Contains The 30s
Ribosome Subunit, Three Trna, And Mrna Molecules. 50s
Ribosome Subunit Is In The File 1giy sp|P62668|RS8_THET2
30S ribosomal protein S8 pdb|1ML5|K Chain K, Structure
Of The E. Coli Ribosomal Termination Complex With
Release Factor 2 pdb|1N36|H Chain H, Structure Of The
Thermus Thermophilus 30s Ribosomal Subunit In The
Presence Of Crystallographically Disordered Codon And
Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched
At The Second Codon Position pdb|1N34|H Chain H,
Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit In The Presence Of Codon And
Crystallographically Disordered Near-Cognate Transfer
Rna Anticodon Stem-Loop Mismatched At The First Codon
Position pdb|1N33|H Chain H, Structure Of The Thermus
Thermophilus 30s Ribosomal Subunit Bound To Codon And
Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched
At The Second Codon Position At The A Site With
Paromomycin pdb|1N32|H Chain H, Structure Of The Thermus
Thermophilus 30s Ribosomal Subunit Bound To Codon And
Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched
At The First Codon Position At The A Site With
Paromomycin pdb|1XNR|H Chain H, Crystal Structure Of An
Inosine-Cytosine Wobble Base Pair In The Context Of The
Decoding Center pdb|1XNQ|H Chain H, Structure Of An
Inosine-Adenine Wobble Base Pair Complex In The Context
Of The Decoding Center pdb|1XMQ|H Chain H, Crystal
Structure Of T6a37-Asllysuuu Aaa-Mrna Bound To The
Decoding Center pdb|1XMO|H Chain H, Crystal Structure Of
Mnm5u34t6a37-Trnalysuuu Complexed With Aag-Mrna In The
Decoding Center pdb|1HR0|H Chain H, Crystal Structure Of
Initiation Factor If1 Bound To The 30s Ribosomal Subunit
pdb|1J5E|H Chain H, Structure Of The Thermus
Thermophilus 30s Ribosomal Subunit pdb|1FKA|H Chain H,
Structure Of Functionally Activated Small Ribosomal
Subunit At 3.3 A Resolution pdb|1EG0|E Chain E, Fitting
Of Components With Known Structure Into An 11.5 A
Cryo-Em Map Of The E.Coli 70s Ribosome pdb|1GIX|K Chain
K, Crystal Structure Of The Ribosome At 5.5 A
Resolution. This File, 1gix, Contains The 30s Ribosome
Subunit, Three Trna, And Mrna Molecules. 50s Ribosome
Subunit Is In The File 1giy pdb|1IBM|H Chain H,
Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit In Complex With A Messenger Rna Fragment And
Cognate Transfer Rna Anticodon Stem-Loop Bound At The A
Site pdb|1IBL|H Chain H, Structure Of The Thermus
Thermophilus 30s Ribosomal Subunit In Complex With A
Messenger Rna Fragment And Cognate Transfer Rna
Anticodon Stem-Loop Bound At The A Site And With The
Antibiotic Paromomycin pdb|1IBK|H Chain H, Structure Of
The Thermus Thermophilus 30s Ribosomal Subunit In
Complex With The Antibiotic Paromomycin pdb|1HNZ|H Chain
H, Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit In Complex With Hygromycin B pdb|1HNX|H Chain H,
Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit In Complex With Pactamycin pdb|1HNW|H Chain H,
Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit In Complex With Tetracycline pdb|1VOZ|H Chain H,
Crystal Structure Of Five 70s Ribosomes From Escherichia
Coli In Complex With Protein Y. This File Contains The
30s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Five 70s Ribosomes And Is Described
In Remark 400. pdb|1VOX|H Chain H, Crystal Structure Of
Five 70s Ribosomes From Escherichia Coli In Complex With
Protein Y. This File Contains The 30s Subunit Of One 70s
Ribosome. The Entire Crystal Structure Contains Five 70s
Ribosomes And Is Described In Remark 400. pdb|1VOV|H
Chain H, Crystal Structure Of Five 70s Ribosomes From
Escherichia Coli In Complex With Protein Y. This File
Contains The 30s Subunit Of One 70s Ribosome. The Entire
Crystal Structure Contains Five 70s Ribosomes And Is
Described In Remark 400. pdb|1VOS|H Chain H, Crystal
Structure Of Five 70s Ribosomes From Escherichia Coli In
Complex With Protein Y. This File Contains The 30s
Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Five 70s Ribosomes And Is Described
In Remark 400. pdb|1VOQ|H Chain H, Crystal Structure Of
Five 70s Ribosomes From Escherichia Coli In Complex With
Protein Y. This File Contains The 30s Subunit Of One 70s
Ribosome. The Entire Crystal Structure Contains Five 70s
Ribosomes And Is Described In Remark 400. pdb|1FJG|H
Chain H, Structure Of The Thermus Thermophilus 30s
Ribosomal Subunit In Complex With The Antibiotics
Streptomycin, Spectinomycin, And Paromomycin
Length = 137



Score = 193 bits (722), Expect = 3e-49
Identities = 137/137 (100%), Positives = 137/137 (100%)

Query: 1 MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLR 60
MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLR
Sbjct: 1 MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLR 60

Query: 61 VYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLT 120
VYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLT
Sbjct: 61 VYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLT 120

Query: 121 DREARKLGVGGELICEV 137
DREARKLGVGGELICEV
Sbjct: 121 DREARKLGVGGELICEV 137