NC_005835 | |
Chromosome | NC_005835 |
Query | gi|46199617 |
Alignment | >1fjgN 1 60 1 60 2e-11 pdb|1PNX|N Chain N, Crystal Structure Of The Wild Type Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pnx, Contains Only Molecules Of The 30s Ribosomal Subunit. The 50s Subunit Is In The Pdb File 1pny. pdb|1PNS|N Chain N, Crystal Structure Of A Streptomycin Dependent Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pns, Contains The 30s Subunit, Two Trnas, And One Mrna Molecule. The 50s Ribosomal Subunit Is In File 1pnu. pdb|1N36|N Chain N, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In The Presence Of Crystallographically Disordered Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The Second Codon Position pdb|1N34|N Chain N, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In The Presence Of Codon And Crystallographically Disordered Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The First Codon Position pdb|1N33|N Chain N, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Bound To Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The Second Codon Position At The A Site With Paromomycin pdb|1N32|N Chain N, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit Bound To Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop Mismatched At The First Codon Position At The A Site With Paromomycin pdb|1J5E|N Chain N, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit pdb|1I97|N Chain N, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With Tetracycline pdb|1I96|N Chain N, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With The Translation Initiation Factor If3 (C-Terminal Domain) pdb|1I95|N Chain N, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With Edeine pdb|1I94|N Chain N, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 pdb|1VOZ|N Chain N, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. pdb|1VOX|N Chain N, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. pdb|1VOV|N Chain N, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. pdb|1VOS|N Chain N, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400. pdb|1VOQ|N Chain N, Crystal Structure Of Five 70s Ribosomes From Escherichia Coli In Complex With Protein Y. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Five 70s Ribosomes And Is Described In Remark 400 Length = 60 Score = 71.1 bits (252), Expect = 5e-12 Identities = 60/60 (100%), Positives = 60/60 (100%) Query: 2 ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW 61 ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW Sbjct: 1 ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW 60 |