>1fjgS 1 84 2 85 2e-32
ref|YP_005293.1| SSU ribosomal protein S19P [Thermus thermophilus HB27]
ref|YP_144954.1| 30S ribosomal protein S19 [Thermus
thermophilus HB8] emb|CAA58878.1| ribosomal protein S19
[Thermus thermophilus] sp|P62660|RS19_THET2 30S
ribosomal protein S19 gb|AAS81666.1| SSU ribosomal
protein S19P [Thermus thermophilus HB27]
dbj|BAD71511.1| 30S ribosomal protein S19 [Thermus
thermophilus HB8] pdb|1JGQ|V Chain V, The Path Of
Messenger Rna Through The Ribosome. This File, 1jgq,
Contains The 30s Ribosome Subunit, Three Trna, And Mrna
Molecules. 50s Ribosome Subunit Is In The File 1giy
pdb|1JGP|V Chain V, The Path Of Messenger Rna Through
The Ribosome. This File, 1jgp, Contains The 30s
Ribosome Subunit, Three Trna, And Mrna Molecules. 50s
Ribosome Subunit Is In The File 1giy pdb|1JGO|V Chain
V, The Path Of Messenger Rna Through The Ribosome. This
File, 1jgo, Contains The 30s Ribosome Subunit, Three
Trna, And Mrna Molecules. 50s Ribosome Subunit Is In
The File 1giy pdb|1ML5|V Chain V, Structure Of The E.
Coli Ribosomal Termination Complex With Release Factor
2 sp|P80381|RS19_THETH 30S ribosomal protein S19
pdb|1XNR|S Chain S, Crystal Structure Of An
Inosine-Cytosine Wobble Base Pair In The Context Of The
Decoding Center pdb|1XNQ|S Chain S, Structure Of An
Inosine-Adenine Wobble Base Pair Complex In The Context
Of The Decoding Center pdb|1XMQ|S Chain S, Crystal
Structure Of T6a37-Asllysuuu Aaa-Mrna Bound To The
Decoding Center pdb|1XMO|S Chain S, Crystal Structure
Of Mnm5u34t6a37-Trnalysuuu Complexed With Aag-Mrna In
The Decoding Center pdb|1HR0|S Chain S, Crystal
Structure Of Initiation Factor If1 Bound To The 30s
Ribosomal Subunit pdb|1FKA|S Chain S, Structure Of
Functionally Activated Small Ribosomal Subunit At 3.3 A
Resolution pdb|1GIX|V Chain V, Crystal Structure Of The
Ribosome At 5.5 A Resolution. This File, 1gix, Contains
The 30s Ribosome Subunit, Three Trna, And Mrna
Molecules. 50s Ribosome Subunit Is In The File 1giy
pdb|1IBM|S Chain S, Structure Of The Thermus
Thermophilus 30s Ribosomal Subunit In Complex With A
Messenger Rna Fragment And Cognate Transfer Rna
Anticodon Stem-Loop Bound At The A Site pdb|1IBL|S
Chain S, Structure Of The Thermus Thermophilus 30s
Ribosomal Subunit In Complex With A Messenger Rna
Fragment And Cognate Transfer Rna Anticodon Stem-Loop
Bound At The A Site And With The Antibiotic Paromomycin
pdb|1IBK|S Chain S, Structure Of The Thermus
Thermophilus 30s Ribosomal Subunit In Complex With The
Antibiotic Paromomycin pdb|1HNZ|S Chain S, Structure Of
The Thermus Thermophilus 30s Ribosomal Subunit In
Complex With Hygromycin B pdb|1HNX|S Chain S, Structure
Of The Thermus Thermophilus 30s Ribosomal Subunit In
Complex With Pactamycin pdb|1HNW|S Chain S, Structure
Of The Thermus Thermophilus 30s Ribosomal Subunit In
Complex With Tetracycline pdb|1FJG|S Chain S, Structure
Of The Thermus Thermophilus 30s Ribosomal Subunit In
Complex With The Antibiotics Streptomycin,
Spectinomycin, And Paromomycin
Length = 84



Score = 129 bits (475), Expect = 1e-29
Identities = 84/84 (100%), Positives = 84/84 (100%)

Query: 2 PRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVY 61
PRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVY
Sbjct: 1 PRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVY 60

Query: 62 ITENMVGHKLGEFAPTRTYRGHGK 85
ITENMVGHKLGEFAPTRTYRGHGK
Sbjct: 61 ITENMVGHKLGEFAPTRTYRGHGK 84