>1fjgR 1 73 16 88 5e-14
gb|AAF27297.1| ribosomal protein S18 [Thermus thermophilus] pdb|1JGQ|U Chain U,
The Path Of Messenger Rna Through The Ribosome. This
File, 1jgq, Contains The 30s Ribosome Subunit, Three
Trna, And Mrna Molecules. 50s Ribosome Subunit Is In
The File 1giy pdb|1JGP|U Chain U, The Path Of Messenger
Rna Through The Ribosome. This File, 1jgp, Contains The
30s Ribosome Subunit, Three Trna, And Mrna Molecules.
50s Ribosome Subunit Is In The File 1giy pdb|1JGO|U
Chain U, The Path Of Messenger Rna Through The
Ribosome. This File, 1jgo, Contains The 30s Ribosome
Subunit, Three Trna, And Mrna Molecules. 50s Ribosome
Subunit Is In The File 1giy pdb|1ML5|U Chain U,
Structure Of The E. Coli Ribosomal Termination Complex
With Release Factor 2 sp|P80382|RS18_THETH 30S
ribosomal protein S18 pdb|1N36|R Chain R, Structure Of
The Thermus Thermophilus 30s Ribosomal Subunit In The
Presence Of Crystallographically Disordered Codon And
Near-Cognate Transfer Rna Anticodon Stem-Loop
Mismatched At The Second Codon Position pdb|1N34|R
Chain R, Structure Of The Thermus Thermophilus 30s
Ribosomal Subunit In The Presence Of Codon And
Crystallographically Disordered Near-Cognate Transfer
Rna Anticodon Stem-Loop Mismatched At The First Codon
Position pdb|1N33|R Chain R, Structure Of The Thermus
Thermophilus 30s Ribosomal Subunit Bound To Codon And
Near-Cognate Transfer Rna Anticodon Stem-Loop
Mismatched At The Second Codon Position At The A Site
With Paromomycin pdb|1N32|R Chain R, Structure Of The
Thermus Thermophilus 30s Ribosomal Subunit Bound To
Codon And Near-Cognate Transfer Rna Anticodon Stem-Loop
Mismatched At The First Codon Position At The A Site
With Paromomycin pdb|1XNR|R Chain R, Crystal Structure
Of An Inosine-Cytosine Wobble Base Pair In The Context
Of The Decoding Center pdb|1XNQ|R Chain R, Structure Of
An Inosine-Adenine Wobble Base Pair Complex In The
Context Of The Decoding Center pdb|1XMQ|R Chain R,
Crystal Structure Of T6a37-Asllysuuu Aaa-Mrna Bound To
The Decoding Center pdb|1XMO|R Chain R, Crystal
Structure Of Mnm5u34t6a37-Trnalysuuu Complexed With
Aag-Mrna In The Decoding Center pdb|1HR0|R Chain R,
Crystal Structure Of Initiation Factor If1 Bound To The
30s Ribosomal Subunit pdb|1J5E|R Chain R, Structure Of
The Thermus Thermophilus 30s Ribosomal Subunit
pdb|1FKA|R Chain R, Structure Of Functionally Activated
Small Ribosomal Subunit At 3.3 A Resolution pdb|1GIX|U
Chain U, Crystal Structure Of The Ribosome At 5.5 A
Resolution. This File, 1gix, Contains The 30s Ribosome
Subunit, Three Trna, And Mrna Molecules. 50s Ribosome
Subunit Is In The File 1giy pdb|1IBM|R Chain R,
Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit In Complex With A Messenger Rna Fragment And
Cognate Transfer Rna Anticodon Stem-Loop Bound At The A
Site pdb|1IBL|R Chain R, Structure Of The Thermus
Thermophilus 30s Ribosomal Subunit In Complex With A
Messenger Rna Fragment And Cognate Transfer Rna
Anticodon Stem-Loop Bound At The A Site And With The
Antibiotic Paromomycin pdb|1IBK|R Chain R, Structure Of
The Thermus Thermophilus 30s Ribosomal Subunit In
Complex With The Antibiotic Paromomycin pdb|1HNZ|R
Chain R, Structure Of The Thermus Thermophilus 30s
Ribosomal Subunit In Complex With Hygromycin B
pdb|1HNX|R Chain R, Structure Of The Thermus
Thermophilus 30s Ribosomal Subunit In Complex With
Pactamycin pdb|1HNW|R Chain R, Structure Of The Thermus
Thermophilus 30s Ribosomal Subunit In Complex With
Tetracycline pdb|1G1X|H Chain H, Structure Of Ribosomal
Proteins S15, S6, S18, And 16s Ribosomal Rna pdb|1G1X|C
Chain C, Structure Of Ribosomal Proteins S15, S6, S18,
And 16s Ribosomal Rna pdb|1FJG|R Chain R, Structure Of
The Thermus Thermophilus 30s Ribosomal Subunit In
Complex With The Antibiotics Streptomycin,
Spectinomycin, And Paromomycin
Length = 73



Score = 77.9 bits (278), Expect = 4e-14
Identities = 72/73 (98%), Positives = 72/73 (98%)

Query: 16 PSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAKTIKRARI 75
PSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLS KEQRILAKTIKRARI
Sbjct: 1 PSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSGKEQRILAKTIKRARI 60

Query: 76 LGLLPFTEKLVRK 88
LGLLPFTEKLVRK
Sbjct: 61 LGLLPFTEKLVRK 73