NC_000913 | |
Chromosome | NC_000913 |
Query | gi|16128588 |
Alignment | >1xvqA 16 164 1 154 7e-23 ref|NP_706463.1| alkyl hydroperoxide reductase, C22 subunit [Shigella flexneri 2a str. 301] gb|AAN42170.1| alkyl hydroperoxide reductase, C22 subunit [Shigella flexneri 2a str. 301] ref|NP_836234.1| alkyl hydroperoxide reductase, C22 subunit [Shigella flexneri 2a str. 2457T] ref|NP_752625.1| Alkyl hydroperoxide reductase C22 protein [Escherichia coli CFT073] gb|AAP16040.1| alkyl hydroperoxide reductase, C22 subunit [Shigella flexneri 2a str. 2457T] gb|AAN79169.1| Alkyl hydroperoxide reductase C22 protein [Escherichia coli CFT073] ref|NP_415138.1| alkyl hydroperoxide reductase, C22 subunit, thioredoxin-like, detoxification of hydroperoxides [Escherichia coli K12] gb|AAC73706.1| alkyl hydroperoxide reductase, C22 subunit; detoxification of hydroperoxides; alkyl hydroperoxide reductase, C22 subunit, thioredoxin-like, detoxification of hydroperoxides [Escherichia coli K12] dbj|BAA02485.1| alkyl hydroperoxide reductase small subunit [Escherichia coli] dbj|BAA35244.1| Alkyl hydroperoxide reductase C22 protein (EC 1.6.4.-) (scrp-23). [Escherichia coli K12] dbj|BAA35235.1| Alkyl hydroperoxide reductase C22 protein (EC 1.6.4.-) (scrp-23). [Escherichia coli K12] sp|P26427|AHPC_ECOLI Alkyl hydroperoxide reductase subunit C (Peroxiredoxin) (Thioredoxin peroxidase) (Alkyl hydroperoxide reductase protein C22) (SCRP-23) (Sulfate starvation-induced protein 8) (SSI8) gb|AAG54940.1| alkyl hydroperoxide reductase, C22 subunit; detoxification of hydroperoxides [Escherichia coli O157:H7 EDL933] dbj|BAB34067.1| alkyl hydroperoxide reductase C22 subunit [Escherichia coli O157:H7] gb|AAB40806.1| alkyl hydroperoxide reductase C22 [Escherichia coli] ref|NP_308671.1| alkyl hydroperoxide reductase C22 subunit [Escherichia coli O157:H7] ref|NP_286332.1| alkyl hydroperoxide reductase, C22 subunit; detoxification of hydroperoxides [Escherichia coli O157:H7 EDL933] Length = 154 Score = 255 bits (958), Expect = 6e-68 Identities = 154/154 (100%), Positives = 154/154 (100%) Query: 1 MSLINTKIKPFKNQAFKNGEFIEITEKDTEGRWSVFFFYPADFTFVCPTELGDVADHYEE 60 MSLINTKIKPFKNQAFKNGEFIEITEKDTEGRWSVFFFYPADFTFVCPTELGDVADHYEE Sbjct: 1 MSLINTKIKPFKNQAFKNGEFIEITEKDTEGRWSVFFFYPADFTFVCPTELGDVADHYEE 60 Query: 61 LQKLGVDVYAVSTDTHFTHKAWHSSSETIAKIKYAMIGDPTGALTRNFDNMREDEGLADR 120 LQKLGVDVYAVSTDTHFTHKAWHSSSETIAKIKYAMIGDPTGALTRNFDNMREDEGLADR Sbjct: 61 LQKLGVDVYAVSTDTHFTHKAWHSSSETIAKIKYAMIGDPTGALTRNFDNMREDEGLADR 120 Query: 121 ATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKA 154 ATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKA Sbjct: 121 ATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKA 154 |