VFA689 | |
Library | VF (Link to library) |
Clone ID | VFA689 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16279-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFA6-D/VFA689Q.Seq.d/ |
Representative seq. ID | VFA689P (Link to Original site) |
Representative DNA sequence | ![]() >VFA689 (VFA689Q) /CSM/VF/VFA6-D/VFA689Q.Seq.d/ |
sequence update | 2001. 6. 1 |
Translated Amino Acid sequence | ![]() *knd*TVASYEXDEKRFLTLLGKLIGETENLQNRPPALIPIEDNAGRHVIEALTPYLKAN |
Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
Homology vs CSM-cDNA | ![]()
|
own update | 2004.12.25 |
Homology vs DNA | ![]()
|
dna update | 2003. 8.17 |
Homology vs Protein | ![]()
|
protein update | 2009. 6.16 |
PSORT | ![]()
|
5' end seq. ID | VFA689F |
5' end seq. | ![]() >VFA689F.Seq |
Length of 5' end seq. | 589 |
3' end seq. ID | VFA689Z |
3' end seq. | ![]() >VFA689Z.Seq |
Length of 3' end seq. | 649 |
Connected seq. ID | VFA689P |
Connected seq. | ![]() >VFA689P.Seq |
Length of connected seq. | 1238 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |