VFI557 | |
Library | VF (Link to library) |
Clone ID | VFI557 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16382-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFI5-C/VFI557Q.Seq.d/ |
Representative seq. ID | VFI557E (Link to Original site) |
Representative DNA sequence | ![]() >VFI557 (VFI557Q) /CSM/VF/VFI5-C/VFI557Q.Seq.d/ |
sequence update | 2001.11.24 |
Translated Amino Acid sequence | ![]() lnsniyi*ii*kwtvkmfkl*lsitvlvcvkpvllvmmphvlfshqllvvqdtlvlwsvw |
Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
Homology vs CSM-cDNA | ![]()
|
own update | 2001.12. 4 |
Homology vs DNA | ![]()
|
dna update | 2009. 1. 2 |
Homology vs Protein | ![]()
|
protein update | 2009. 7.10 |
PSORT | ![]()
|
5' end seq. ID | VFI557F |
5' end seq. | ![]() >VFI557F.Seq |
Length of 5' end seq. | 625 |
3' end seq. ID | VFI557Z |
3' end seq. | ![]() >VFI557Z.Seq |
Length of 3' end seq. | 748 |
Connected seq. ID | VFI557P |
Connected seq. | ![]() >VFI557P.Seq |
Length of connected seq. | 1353 |
Full length Seq ID | VFI557E |
Full length Seq. | ![]() >VFI557E.Seq |
Length of full length seq. | 1199 |