| VFI557 | |
| Library | VF (Link to library) |
| Clone ID | VFI557 (Link to dictyBase) |
| Atlas ID | - |
| NBRP ID | - |
| dictyBase ID | - |
| Link to Contig | Contig-U16382-1 |
| Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFI5-C/VFI557Q.Seq.d/ |
| Representative seq. ID | VFI557E (Link to Original site) |
| Representative DNA sequence | ![]() >VFI557 (VFI557Q) /CSM/VF/VFI5-C/VFI557Q.Seq.d/ |
| sequence update | 2001.11.24 |
| Translated Amino Acid sequence | ![]() lnsniyi*ii*kwtvkmfkl*lsitvlvcvkpvllvmmphvlfshqllvvqdtlvlwsvw |
| Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
| Homology vs CSM-cDNA | ![]()
|
| own update | 2001.12. 4 |
| Homology vs DNA | ![]()
|
| dna update | 2009. 1. 2 |
| Homology vs Protein | ![]()
|
| protein update | 2009. 7.10 |
| PSORT | ![]()
|
| 5' end seq. ID | VFI557F |
| 5' end seq. | ![]() >VFI557F.Seq |
| Length of 5' end seq. | 625 |
| 3' end seq. ID | VFI557Z |
| 3' end seq. | ![]() >VFI557Z.Seq |
| Length of 3' end seq. | 748 |
| Connected seq. ID | VFI557P |
| Connected seq. | ![]() >VFI557P.Seq |
| Length of connected seq. | 1353 |
| Full length Seq ID | VFI557E |
| Full length Seq. | ![]() >VFI557E.Seq |
| Length of full length seq. | 1199 |