VFJ124 | |
Library | VF (Link to library) |
Clone ID | VFJ124 (Link to dictyBase) |
Atlas ID | - |
NBRP ID | - |
dictyBase ID | - |
Link to Contig | Contig-U16272-1 |
Original site URL | http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFJ1-A/VFJ124Q.Seq.d/ |
Representative seq. ID | VFJ124P (Link to Original site) |
Representative DNA sequence | ![]() >VFJ124 (VFJ124Q) /CSM/VF/VFJ1-A/VFJ124Q.Seq.d/ |
sequence update | 2001.11.22 |
Translated Amino Acid sequence | ![]() LVLLNNNNNMSHRKFEAPRHGNLGFRPRKRAARHQGKVKSFPKDDRTQKVHLTAFMGYKA |
Translated Amino Acid sequence (All Frames) | ![]() Frame A: |
Homology vs CSM-cDNA | ![]()
|
own update | 2004.12.25 |
Homology vs DNA | ![]()
|
dna update | 2009. 1.12 |
Homology vs Protein | ![]()
|
protein update | 2009. 6.21 |
PSORT | ![]()
|
5' end seq. ID | VFJ124F |
5' end seq. | ![]() >VFJ124F.Seq |
Length of 5' end seq. | 621 |
3' end seq. ID | VFJ124Z |
3' end seq. | ![]() >VFJ124Z.Seq |
Length of 3' end seq. | 665 |
Connected seq. ID | VFJ124P |
Connected seq. | ![]() >VFJ124P.Seq |
Length of connected seq. | 1266 |
Full length Seq ID | - |
Full length Seq. | - |
Length of full length seq. | - |