| CBRC-DNOV-01-0923 | |
| ID | CBRC-DNOV-01-0923 |
| Pseudo | |
| Novel | Novel |
| Chromosome | UN |
| Level | B |
| Family | UNKNOWN |
| Alternativeproducts | |
| Swiss-Prot BLAST top hit | SOTB_HAEIN [BLAST OUTPUT] |
| Swiss-Prot BLAST top hit (E-value) | 3.0 |
| Swiss-Prot BLAST top hit (Identity) | 42% |
| NCBI nr-aa BLAST top hit | ref|YP_001099846.1| outer membrane copper (silver) and drug transport protein (RND family) [Herminiimonas arsenicoxydans] emb|CAL61719.1| outer membrane copper (silver) and drug transport protein (RND family) [Herminiimonas arsenicoxydans] [BLAST OUTPUT] |
| NCBI nr-aa BLAST top hit (E-value) | 9.4 |
| NCBI nr-aa BLAST top hit (Identity) | 31% |
| NCBI Unigene BLAST top hit | [BLAST OUTPUT] |
| NCBI Unigene BLAST top hit (E-value) | - |
| NCBI Unigene BLAST top hit (Identity) | - |
| Expression | - |
| Ligand | - |
| G-protein coupling | - |
| Sequence | MNYLAVLALKLSWTYDLTSDPGTHLSVLVGHQVGRTLPFQKGSIVNLNRFCILYSNKSLN ADPLHPKEDLYLPFPHLAFNFMPGTFFPIELTFYNRIIYQHFCPCIFGTLSSSVIKTFLK MRLKCFAPVKRPHKNVLMFVSNSWLCVSKLLLTFTTQTIILKF |
| Leftend | 1322 |
| Rightend | 1813 |