BP915235
Clone id YMU001_000069_B04
Library
Length 215
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000069_B04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CATTTTCTGCTGATGGCACAGTATGGCATACGTTTCTTGGTGCTTGTCGCTTTCGTGGGG
ATACGAAGCTTGGAAGGTGGGCCTTTGGATATGCAGTGCAAGAATATGATGAAGTTGATG
CTGCTTATGTCTCTCTGGGTGACTTATACGGCTGTCACTAATAGGCAAGAGGGTAGGCTG
AACTTCTGAGATAAAGGTTGAATATGGGGCCATAT
■■Homology search results ■■ -
sp_hit_id Q5G1T1
Definition sp|Q5G1T1|PP272_ARATH Pentatricopeptide repeat-containing protein At3g49170, chloroplastic OS=Arabidopsis thaliana
Align length 51
Score (bit) 48.1
E-value 1.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915235|Adiantum capillus-veneris mRNA, clone:
YMU001_000069_B04.
(215 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5G1T1|PP272_ARATH Pentatricopeptide repeat-containing protei... 48 1e-05
sp|Q9SN85|PP267_ARATH Pentatricopeptide repeat-containing protei... 40 0.005
sp|Q9ZUW3|PP172_ARATH Pentatricopeptide repeat-containing protei... 40 0.005
sp|Q9MA85|PP215_ARATH Pentatricopeptide repeat-containing protei... 39 0.008
sp|Q9SKQ4|PP167_ARATH Pentatricopeptide repeat-containing protei... 39 0.008
sp|Q9C9I6|PP116_ARATH Pentatricopeptide repeat-containing protei... 39 0.010
sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protei... 36 0.052
sp|Q9CAA8|PP108_ARATH Putative pentatricopeptide repeat-containi... 36 0.052
sp|Q9CA56|PP121_ARATH Pentatricopeptide repeat-containing protei... 36 0.068
sp|Q9FK93|PP406_ARATH Pentatricopeptide repeat-containing protei... 35 0.088
sp|Q3E9N1|PP359_ARATH Pentatricopeptide repeat-containing protei... 35 0.088
sp|Q9LXF2|PP385_ARATH Pentatricopeptide repeat-containing protei... 35 0.15
sp|Q9FGL1|PP423_ARATH Putative pentatricopeptide repeat-containi... 34 0.20
sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protei... 34 0.20
sp|O49680|PP324_ARATH Pentatricopeptide repeat-containing protei... 33 0.34
sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protei... 33 0.34
sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protei... 33 0.34
sp|Q9SZT8|PP354_ARATH Pentatricopeptide repeat-containing protei... 33 0.44
sp|P0C899|PP271_ARATH Putative pentatricopeptide repeat-containi... 33 0.44
sp|Q9LFL5|PP390_ARATH Putative pentatricopeptide repeat-containi... 33 0.57
sp|Q3ECB8|PP128_ARATH Pentatricopeptide repeat-containing protei... 33 0.57
sp|P0C898|PP232_ARATH Putative pentatricopeptide repeat-containi... 32 0.75
sp|Q9C9H9|PP114_ARATH Pentatricopeptide repeat-containing protei... 32 0.75
sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protei... 32 1.3
sp|Q9SMZ2|PP347_ARATH Pentatricopeptide repeat-containing protei... 32 1.3
sp|A8MQA3|PP330_ARATH Pentatricopeptide repeat-containing protei... 32 1.3
sp|O23337|PP311_ARATH Pentatricopeptide repeat-containing protei... 32 1.3
sp|Q9M2Y4|PP276_ARATH Pentatricopeptide repeat-containing protei... 31 1.7
sp|Q9SJZ3|PP169_ARATH Pentatricopeptide repeat-containing protei... 31 1.7
sp|O80488|PPR23_ARATH Pentatricopeptide repeat-containing protei... 31 2.2

>sp|Q5G1T1|PP272_ARATH Pentatricopeptide repeat-containing protein
At3g49170, chloroplastic OS=Arabidopsis thaliana
GN=EMB2261 PE=2 SV=1
Length = 850

Score = 48.1 bits (113), Expect = 1e-05
Identities = 22/51 (43%), Positives = 30/51 (58%)
Frame = +3

Query: 3 FSADGTVWHTFLGACRFRGDTKLGRWAFGYAVQEYDEVDAAYVSLGDLYGC 155
F AD VW TFLGACR +T+LG+ A ++ AAY+ L ++Y C
Sbjct: 639 FQADVLVWRTFLGACRVHSNTELGKLAARKILELDPNEPAAYIQLSNIYAC 689


>sp|Q9SN85|PP267_ARATH Pentatricopeptide repeat-containing protein
At3g47530 OS=Arabidopsis thaliana GN=PCMP-H76 PE=2 SV=1
Length = 591

Score = 39.7 bits (91), Expect = 0.005
Identities = 18/46 (39%), Positives = 24/46 (52%)
Frame = +3

Query: 12 DGTVWHTFLGACRFRGDTKLGRWAFGYAVQEYDEVDAAYVSLGDLY 149
D T+W T LGACR GD +LG + ++ E YV L + Y
Sbjct: 386 DSTIWRTLLGACRVHGDVELGERVISHLIELKAEEAGDYVLLLNTY 431


>sp|Q9ZUW3|PP172_ARATH Pentatricopeptide repeat-containing protein
At2g27610 OS=Arabidopsis thaliana GN=PCMP-H60 PE=2 SV=1
Length = 868

Score = 39.7 bits (91), Expect = 0.005
Identities = 20/47 (42%), Positives = 25/47 (53%)
Frame = +3

Query: 9 ADGTVWHTFLGACRFRGDTKLGRWAFGYAVQEYDEVDAAYVSLGDLY 149
A T+W T L ACR T+LGR A + E AAYV L ++Y
Sbjct: 662 AGSTIWRTILAACRVHKKTELGRLAAEKIIAMKPEDSAAYVLLSNMY 708


>sp|Q9MA85|PP215_ARATH Pentatricopeptide repeat-containing protein
At3g05340 OS=Arabidopsis thaliana GN=PCMP-E83 PE=2 SV=2
Length = 658

Score = 38.9 bits (89), Expect = 0.008
Identities = 15/46 (32%), Positives = 26/46 (56%)
Frame = +3

Query: 12 DGTVWHTFLGACRFRGDTKLGRWAFGYAVQEYDEVDAAYVSLGDLY 149
D +W LGAC F GDT++G +A Q + +A++ + ++Y
Sbjct: 525 DCKIWQALLGACSFHGDTEVGEYAAEQLFQTAPDSSSAHILIANIY 570


>sp|Q9SKQ4|PP167_ARATH Pentatricopeptide repeat-containing protein
At2g21090 OS=Arabidopsis thaliana GN=PCMP-E48 PE=2 SV=1
Length = 597

Score = 38.9 bits (89), Expect = 0.008
Identities = 17/52 (32%), Positives = 26/52 (50%)
Frame = +3

Query: 3 FSADGTVWHTFLGACRFRGDTKLGRWAFGYAVQEYDEVDAAYVSLGDLYGCH 158
F D +W+ LG CR G+ +LG+ A ++ E A Y+ L +Y H
Sbjct: 477 FEPDKHIWNAILGVCRIHGNEELGKKAADELIKLDPESSAPYILLSSIYADH 528


>sp|Q9C9I6|PP116_ARATH Pentatricopeptide repeat-containing protein
At1g71490 OS=Arabidopsis thaliana GN=PCMP-E67 PE=2 SV=1
Length = 681

Score = 38.5 bits (88), Expect = 0.010
Identities = 15/49 (30%), Positives = 25/49 (51%)
Frame = +3

Query: 3 FSADGTVWHTFLGACRFRGDTKLGRWAFGYAVQEYDEVDAAYVSLGDLY 149
+ G W T L AC G+T++G+WA ++ E YV + ++Y
Sbjct: 547 YKPSGATWATLLNACHIHGNTQIGKWAAEKLLEMKPENPGYYVLIANMY 595


>sp|Q9FI80|PP425_ARATH Pentatricopeptide repeat-containing protein
At5g48910 OS=Arabidopsis thaliana GN=PCMP-H38 PE=2 SV=1
Length = 646

Score = 36.2 bits (82), Expect = 0.052
Identities = 14/46 (30%), Positives = 24/46 (52%)
Frame = +3

Query: 12 DGTVWHTFLGACRFRGDTKLGRWAFGYAVQEYDEVDAAYVSLGDLY 149
D +W LGACR +G+ ++G+ + AYV+L ++Y
Sbjct: 442 DDVIWKALLGACRMQGNVEMGKRVANILMDMVPHDSGAYVALSNMY 487


>sp|Q9CAA8|PP108_ARATH Putative pentatricopeptide repeat-containing
protein At1g68930 OS=Arabidopsis thaliana GN=PCMP-H22
PE=3 SV=1
Length = 743

Score = 36.2 bits (82), Expect = 0.052
Identities = 16/49 (32%), Positives = 24/49 (48%)
Frame = +3

Query: 3 FSADGTVWHTFLGACRFRGDTKLGRWAFGYAVQEYDEVDAAYVSLGDLY 149
F D W T L ACR +G+ ++G+WA ++ A Y L +Y
Sbjct: 536 FPPDAIGWTTLLSACRNKGNLEIGKWAAESLIELDPHHPAGYTLLSSIY 584


>sp|Q9CA56|PP121_ARATH Pentatricopeptide repeat-containing protein
At1g74600, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-E69 PE=2 SV=1
Length = 895

Score = 35.8 bits (81), Expect = 0.068
Identities = 16/45 (35%), Positives = 25/45 (55%)
Frame = +3

Query: 12 DGTVWHTFLGACRFRGDTKLGRWAFGYAVQEYDEVDAAYVSLGDL 146
D VW T L AC+ G+ +LG+ A A++ AY+SL ++
Sbjct: 820 DALVWGTLLAACKIHGEVELGKVAAKKAIELEPSDAGAYISLSNI 864


>sp|Q9FK93|PP406_ARATH Pentatricopeptide repeat-containing protein
At5g39680 OS=Arabidopsis thaliana GN=EMB2744 PE=2 SV=1
Length = 710

Score = 35.4 bits (80), Expect = 0.088
Identities = 15/46 (32%), Positives = 24/46 (52%)
Frame = +3

Query: 12 DGTVWHTFLGACRFRGDTKLGRWAFGYAVQEYDEVDAAYVSLGDLY 149
D W T L AC R + +LG+ YA+++Y YV L +++
Sbjct: 506 DVVAWRTLLNACYVRRNYRLGKKVAEYAIEKYPNDSGVYVLLSNIH 551


tr_hit_id A7R627
Definition tr|A7R627|A7R627_VITVI Chromosome undetermined scaffold_1140, whole genome shotgun sequence (Fragment) OS=Vitis vinifera
Align length 47
Score (bit) 45.8
E-value 0.001
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915235|Adiantum capillus-veneris mRNA, clone:
YMU001_000069_B04.
(215 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7R627|A7R627_VITVI Chromosome undetermined scaffold_1140, wh... 46 0.001
tr|A7R3F3|A7R3F3_VITVI Chromosome undetermined scaffold_518, who... 46 0.001
tr|A7QTX0|A7QTX0_VITVI Chromosome undetermined scaffold_171, who... 44 0.004
tr|A7QV00|A7QV00_VITVI Chromosome undetermined scaffold_183, who... 41 0.027
tr|A7P2H4|A7P2H4_VITVI Chromosome chr1 scaffold_5, whole genome ... 41 0.027
tr|A5BGC7|A5BGC7_VITVI Putative uncharacterized protein OS=Vitis... 41 0.027
tr|A7P682|A7P682_VITVI Chromosome chr4 scaffold_6, whole genome ... 38 0.22
tr|A5ATQ0|A5ATQ0_VITVI Putative uncharacterized protein OS=Vitis... 38 0.22
tr|A7PNA8|A7PNA8_VITVI Chromosome chr1 scaffold_22, whole genome... 38 0.29
tr|Q5W963|Q5W963_PHYPA PPR1106-17 OS=Physcomitrella patens PE=2 ... 37 0.38
tr|A9T5P5|A9T5P5_PHYPA Predicted protein OS=Physcomitrella paten... 37 0.38
tr|A7P886|A7P886_VITVI Chromosome chr3 scaffold_8, whole genome ... 37 0.38
tr|A7NSK1|A7NSK1_VITVI Chromosome chr18 scaffold_1, whole genome... 37 0.38
tr|Q7XUP0|Q7XUP0_ORYSJ Os04g0514500 protein OS=Oryza sativa subs... 37 0.50
tr|Q1G366|Q1G366_ARATH Putative uncharacterized protein OS=Arabi... 37 0.50
tr|Q01I18|Q01I18_ORYSA OSIGBa0140J09.3 protein OS=Oryza sativa G... 37 0.50
tr|B8AS37|B8AS37_ORYSI Putative uncharacterized protein OS=Oryza... 37 0.50
tr|A7R0D7|A7R0D7_VITVI Chromosome chr6 scaffold_305, whole genom... 37 0.50
tr|A7PAH3|A7PAH3_VITVI Chromosome chr14 scaffold_9, whole genome... 37 0.50
tr|A5B3U0|A5B3U0_VITVI Putative uncharacterized protein OS=Vitis... 37 0.50
tr|A3AVJ5|A3AVJ5_ORYSJ Putative uncharacterized protein OS=Oryza... 37 0.50
tr|A0ME49|A0ME49_ARATH Putative uncharacterized protein (Fragmen... 37 0.50
tr|A5AIF3|A5AIF3_VITVI Putative uncharacterized protein OS=Vitis... 37 0.65
tr|Q6ETD1|Q6ETD1_ORYSJ Os02g0106300 protein OS=Oryza sativa subs... 36 0.85
tr|Q2QUQ5|Q2QUQ5_ORYSJ Pentatricopeptide, putative, expressed OS... 36 0.85
tr|Q0IP37|Q0IP37_ORYSJ Os12g0256900 protein OS=Oryza sativa subs... 36 0.85
tr|B6SXJ8|B6SXJ8_MAIZE Selenium-binding protein-like OS=Zea mays... 36 0.85
tr|A7R3M9|A7R3M9_VITVI Chromosome chr2 scaffold_541, whole genom... 36 0.85
tr|A7PMY8|A7PMY8_VITVI Chromosome chr14 scaffold_21, whole genom... 36 0.85
tr|A3CGD4|A3CGD4_ORYSJ Putative uncharacterized protein OS=Oryza... 36 0.85

>tr|A7R627|A7R627_VITVI Chromosome undetermined scaffold_1140, whole
genome shotgun sequence (Fragment) OS=Vitis vinifera
GN=GSVIVT00007922001 PE=4 SV=1
Length = 803

Score = 45.8 bits (107), Expect = 0.001
Identities = 21/47 (44%), Positives = 30/47 (63%)
Frame = +3

Query: 9 ADGTVWHTFLGACRFRGDTKLGRWAFGYAVQEYDEVDAAYVSLGDLY 149
AD VW T LGACR G+T+LGR A +++ + AAY+ L +L+
Sbjct: 609 ADALVWRTLLGACRVHGNTELGRHAAEMILEQEPDDPAAYILLSNLH 655


>tr|A7R3F3|A7R3F3_VITVI Chromosome undetermined scaffold_518, whole
genome shotgun sequence (Fragment) OS=Vitis vinifera
GN=GSVIVT00013634001 PE=4 SV=1
Length = 1029

Score = 45.8 bits (107), Expect = 0.001
Identities = 21/47 (44%), Positives = 30/47 (63%)
Frame = +3

Query: 9 ADGTVWHTFLGACRFRGDTKLGRWAFGYAVQEYDEVDAAYVSLGDLY 149
AD VW T LGACR G+T+LGR A +++ + AAY+ L +L+
Sbjct: 824 ADALVWRTLLGACRVHGNTELGRHAAEMILEQEPDDPAAYILLSNLH 870


>tr|A7QTX0|A7QTX0_VITVI Chromosome undetermined scaffold_171, whole
genome shotgun sequence (Fragment) OS=Vitis vinifera
GN=GSVIVT00006516001 PE=4 SV=1
Length = 737

Score = 43.9 bits (102), Expect = 0.004
Identities = 20/47 (42%), Positives = 29/47 (61%)
Frame = +3

Query: 9 ADGTVWHTFLGACRFRGDTKLGRWAFGYAVQEYDEVDAAYVSLGDLY 149
AD VW T LGAC G+T+LGR A +++ + AAY+ L +L+
Sbjct: 532 ADALVWRTLLGACHVHGNTELGRHAAEMILEQEPDDPAAYILLSNLH 578


>tr|A7QV00|A7QV00_VITVI Chromosome undetermined scaffold_183, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00007089001 PE=4 SV=1
Length = 692

Score = 41.2 bits (95), Expect = 0.027
Identities = 18/43 (41%), Positives = 24/43 (55%)
Frame = +3

Query: 21 VWHTFLGACRFRGDTKLGRWAFGYAVQEYDEVDAAYVSLGDLY 149
+W + L CR G+ +LG WA +Q E DAAYV L +Y
Sbjct: 618 IWRSLLNGCRIHGNKELGEWAAKKLLQLVPENDAAYVLLSKVY 660


>tr|A7P2H4|A7P2H4_VITVI Chromosome chr1 scaffold_5, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00030057001
PE=4 SV=1
Length = 671

Score = 41.2 bits (95), Expect = 0.027
Identities = 18/46 (39%), Positives = 27/46 (58%)
Frame = +3

Query: 12 DGTVWHTFLGACRFRGDTKLGRWAFGYAVQEYDEVDAAYVSLGDLY 149
DG +W + LGACR G+ +LG +A + + E AYV L ++Y
Sbjct: 467 DGAIWGSLLGACRVHGNVELGEFAAKHLFELEPENPGAYVLLSNIY 512


>tr|A5BGC7|A5BGC7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_032085 PE=4 SV=1
Length = 748

Score = 41.2 bits (95), Expect = 0.027
Identities = 18/46 (39%), Positives = 27/46 (58%)
Frame = +3

Query: 12 DGTVWHTFLGACRFRGDTKLGRWAFGYAVQEYDEVDAAYVSLGDLY 149
DG +W + LGACR G+ +LG +A + + E AYV L ++Y
Sbjct: 534 DGAIWGSLLGACRVHGNVELGEFAAKHLFELEPENPGAYVLLSNIY 579


>tr|A7P682|A7P682_VITVI Chromosome chr4 scaffold_6, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00032815001
PE=4 SV=1
Length = 718

Score = 38.1 bits (87), Expect = 0.22
Identities = 18/50 (36%), Positives = 24/50 (48%)
Frame = +3

Query: 3 FSADGTVWHTFLGACRFRGDTKLGRWAFGYAVQEYDEVDAAYVSLGDLYG 152
F D VW T LGACR GD +L + ++ E YV L ++G
Sbjct: 529 FEPDAMVWKTLLGACRTCGDIELASQVASHLLELEPEEHCTYVLLSSMFG 578


>tr|A5ATQ0|A5ATQ0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_005195 PE=4 SV=1
Length = 800

Score = 38.1 bits (87), Expect = 0.22
Identities = 18/50 (36%), Positives = 24/50 (48%)
Frame = +3

Query: 3 FSADGTVWHTFLGACRFRGDTKLGRWAFGYAVQEYDEVDAAYVSLGDLYG 152
F D VW T LGACR GD +L + ++ E YV L ++G
Sbjct: 549 FEPDAMVWKTLLGACRTCGDIELASQVASHLLELEPEEHCTYVLLSSMFG 598


>tr|A7PNA8|A7PNA8_VITVI Chromosome chr1 scaffold_22, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00021165001
PE=4 SV=1
Length = 697

Score = 37.7 bits (86), Expect = 0.29
Identities = 16/42 (38%), Positives = 23/42 (54%)
Frame = +3

Query: 24 WHTFLGACRFRGDTKLGRWAFGYAVQEYDEVDAAYVSLGDLY 149
W T L +CR GD ++G+WA + + A+YV L LY
Sbjct: 497 WATLLSSCRVHGDMEIGKWAADSLIALEPQNPASYVLLSSLY 538


>tr|Q5W963|Q5W963_PHYPA PPR1106-17 OS=Physcomitrella patens PE=2 SV=2
Length = 1106

Score = 37.4 bits (85), Expect = 0.38
Identities = 18/49 (36%), Positives = 24/49 (48%)
Frame = +3

Query: 3 FSADGTVWHTFLGACRFRGDTKLGRWAFGYAVQEYDEVDAAYVSLGDLY 149
F D VW T LGACR G+ L A A++ A Y+ L ++Y
Sbjct: 899 FPPDAAVWETLLGACRIHGNIALAEHAANNALKLNARNPAVYILLSNVY 947