BP915867
Clone id YMU001_000078_E11
Library
Length 358
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000078_E11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTCCAAAACCAATAGATGAGGCTTGTCTCCTTTCTGCAATGGTCTTTTCCAAGTCAACGA
AAGCACCTCCACAAATGAAAAGAATATCCTTCGTATCTACCTGTATATAATCTCCTCTCG
GATGCTTCCGCACACCTTTTTCTGGGACATTCACAACCGTTCCCTCCAACATCTTTAGCA
GGGCCTGCTGCACGCCTTCTCCTGACACATCTCTACTAATGTTTACACTTTCCGCCTTCT
TTGTGATTTTATCCACCTCATCAATGTAAACAATGCCCTGTTGAGCAGCTGGAACGTTCA
ATTCAGCAACCGTAAGCAGTTTGTACAAAATAGACTCCACATCTTCTCCAACATACCC
■■Homology search results ■■ -
sp_hit_id A8LJA7
Definition sp|A8LJA7|CLPX_DINSH ATP-dependent Clp protease ATP-binding subunit clpX OS=Dinoroseobacter shibae (strain DFL 12)
Align length 119
Score (bit) 165.0
E-value 8.0e-41
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915867|Adiantum capillus-veneris mRNA, clone:
YMU001_000078_E11.
(358 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A8LJA7|CLPX_DINSH ATP-dependent Clp protease ATP-binding subu... 165 8e-41
sp|A4WSH9|CLPX_RHOS5 ATP-dependent Clp protease ATP-binding subu... 164 1e-40
sp|A3PKS0|CLPX_RHOS1 ATP-dependent Clp protease ATP-binding subu... 164 1e-40
sp|Q5LUP9|CLPX_SILPO ATP-dependent Clp protease ATP-binding subu... 164 1e-40
sp|Q2NDC1|CLPX_ERYLH ATP-dependent Clp protease ATP-binding subu... 163 2e-40
sp|Q3J1G7|CLPX_RHOS4 ATP-dependent Clp protease ATP-binding subu... 163 3e-40
sp|Q2G3T4|CLPX_NOVAD ATP-dependent Clp protease ATP-binding subu... 163 3e-40
sp|Q8YQX7|CLPX_ANASP ATP-dependent Clp protease ATP-binding subu... 163 3e-40
sp|Q28NI8|CLPX_JANSC ATP-dependent Clp protease ATP-binding subu... 162 4e-40
sp|Q3M727|CLPX_ANAVT ATP-dependent Clp protease ATP-binding subu... 162 4e-40
sp|Q55510|CLPX_SYNY3 ATP-dependent Clp protease ATP-binding subu... 162 5e-40
sp|Q1GGF7|CLPX_SILST ATP-dependent Clp protease ATP-binding subu... 162 5e-40
sp|Q165G0|CLPX_ROSDO ATP-dependent Clp protease ATP-binding subu... 162 5e-40
sp|Q2W3I0|CLPX_MAGMM ATP-dependent Clp protease ATP-binding subu... 162 5e-40
sp|Q5N1P7|CLPX_SYNP6 ATP-dependent Clp protease ATP-binding subu... 162 6e-40
sp|O34126|CLPX_SYNE7 ATP-dependent Clp protease ATP-binding subu... 162 6e-40
sp|A5V3U4|CLPX_SPHWW ATP-dependent Clp protease ATP-binding subu... 161 8e-40
sp|B0JL96|CLPX_MICAN ATP-dependent Clp protease ATP-binding subu... 161 8e-40
sp|Q2JLU2|CLPX_SYNJB ATP-dependent Clp protease ATP-binding subu... 161 1e-39
sp|Q2JW64|CLPX_SYNJA ATP-dependent Clp protease ATP-binding subu... 161 1e-39
sp|A1B1H7|CLPX_PARDP ATP-dependent Clp protease ATP-binding subu... 161 1e-39
sp|Q89KG2|CLPX_BRAJA ATP-dependent Clp protease ATP-binding subu... 161 1e-39
sp|Q118P6|CLPX_TRIEI ATP-dependent Clp protease ATP-binding subu... 160 1e-39
sp|Q11J59|CLPX_MESSB ATP-dependent Clp protease ATP-binding subu... 160 1e-39
sp|O87708|CLPX_CAUCR ATP-dependent Clp protease ATP-binding subu... 160 1e-39
sp|B0SZ62|CLPX_CAUSK ATP-dependent Clp protease ATP-binding subu... 160 2e-39
sp|Q5NNY7|CLPX_ZYMMO ATP-dependent Clp protease ATP-binding subu... 160 2e-39
sp|A6U7U8|CLPX_SINMW ATP-dependent Clp protease ATP-binding subu... 160 2e-39
sp|Q92QQ2|CLPX_RHIME ATP-dependent Clp protease ATP-binding subu... 160 2e-39
sp|Q2K9U6|CLPX_RHIEC ATP-dependent Clp protease ATP-binding subu... 160 2e-39

>sp|A8LJA7|CLPX_DINSH ATP-dependent Clp protease ATP-binding subunit
clpX OS=Dinoroseobacter shibae (strain DFL 12) GN=clpX
PE=3 SV=1
Length = 419

Score = 165 bits (417), Expect = 8e-41
Identities = 80/119 (67%), Positives = 102/119 (85%)
Frame = -1

Query: 358 GYVGEDVESILYKLLTVAELNVPAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQAL 179
GYVGEDVE+I+ KLL +E NV AQ+GIVYIDEVDKIT+K+++ +I+RDVSGEGVQQAL
Sbjct: 149 GYVGEDVENIILKLLQASEYNVERAQRGIVYIDEVDKITRKSDNPSITRDVSGEGVQQAL 208

Query: 178 LKMLEGTVVNVPEKGVRKHPRGDYIQVDTKDILFICGGAFVDLEKTIAERRQASSIGFG 2
LK++EGTV +VP +G RKHP+ +++QVDT +ILFICGGAF LEK IA+R + S+IGFG
Sbjct: 209 LKIMEGTVASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLEKIIAQRGKGSAIGFG 267


>sp|A4WSH9|CLPX_RHOS5 ATP-dependent Clp protease ATP-binding subunit
clpX OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH
2.4.3) GN=clpX PE=3 SV=1
Length = 421

Score = 164 bits (416), Expect = 1e-40
Identities = 80/119 (67%), Positives = 101/119 (84%)
Frame = -1

Query: 358 GYVGEDVESILYKLLTVAELNVPAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQAL 179
GYVGEDVE+I+ KLL +E NV AQ+GIVYIDEVDKIT+K+++ +I+RDVSGEGVQQAL
Sbjct: 150 GYVGEDVENIILKLLQASEYNVERAQRGIVYIDEVDKITRKSDNPSITRDVSGEGVQQAL 209

Query: 178 LKMLEGTVVNVPEKGVRKHPRGDYIQVDTKDILFICGGAFVDLEKTIAERRQASSIGFG 2
LK++EGTV +VP +G RKHP+ +++QVDT +ILFICGGAF LEK IA+R + S IGFG
Sbjct: 210 LKIMEGTVASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLEKIIAQRGKGSGIGFG 268


>sp|A3PKS0|CLPX_RHOS1 ATP-dependent Clp protease ATP-binding subunit
clpX OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH
2.4.9) GN=clpX PE=3 SV=1
Length = 421

Score = 164 bits (416), Expect = 1e-40
Identities = 80/119 (67%), Positives = 101/119 (84%)
Frame = -1

Query: 358 GYVGEDVESILYKLLTVAELNVPAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQAL 179
GYVGEDVE+I+ KLL +E NV AQ+GIVYIDEVDKIT+K+++ +I+RDVSGEGVQQAL
Sbjct: 150 GYVGEDVENIILKLLQASEYNVERAQRGIVYIDEVDKITRKSDNPSITRDVSGEGVQQAL 209

Query: 178 LKMLEGTVVNVPEKGVRKHPRGDYIQVDTKDILFICGGAFVDLEKTIAERRQASSIGFG 2
LK++EGTV +VP +G RKHP+ +++QVDT +ILFICGGAF LEK IA+R + S IGFG
Sbjct: 210 LKIMEGTVASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLEKIIAQRGKGSGIGFG 268


>sp|Q5LUP9|CLPX_SILPO ATP-dependent Clp protease ATP-binding subunit
clpX OS=Silicibacter pomeroyi GN=clpX PE=3 SV=1
Length = 424

Score = 164 bits (415), Expect = 1e-40
Identities = 79/119 (66%), Positives = 102/119 (85%)
Frame = -1

Query: 358 GYVGEDVESILYKLLTVAELNVPAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQAL 179
GYVGEDVE+I+ KLL +E NV AQ+GIVYIDEVDKIT+K+E+ +I+RDVSGEGVQQAL
Sbjct: 154 GYVGEDVENIILKLLQASEYNVERAQRGIVYIDEVDKITRKSENPSITRDVSGEGVQQAL 213

Query: 178 LKMLEGTVVNVPEKGVRKHPRGDYIQVDTKDILFICGGAFVDLEKTIAERRQASSIGFG 2
LK++EGTV +VP +G RKHP+ +++QVDT +ILFICGGAF L+K IA+R + S++GFG
Sbjct: 214 LKLMEGTVASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLDKIIAQRGKGSAMGFG 272


>sp|Q2NDC1|CLPX_ERYLH ATP-dependent Clp protease ATP-binding subunit
clpX OS=Erythrobacter litoralis (strain HTCC2594)
GN=clpX PE=3 SV=1
Length = 423

Score = 163 bits (413), Expect = 2e-40
Identities = 79/119 (66%), Positives = 99/119 (83%)
Frame = -1

Query: 358 GYVGEDVESILYKLLTVAELNVPAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQAL 179
GYVGEDVE+I+ KLL ++ NV AQ GIVYIDE+DKIT+KAE+ +I+RDVSGEGVQQAL
Sbjct: 152 GYVGEDVENIILKLLQASDYNVDKAQHGIVYIDEIDKITRKAENPSITRDVSGEGVQQAL 211

Query: 178 LKMLEGTVVNVPEKGVRKHPRGDYIQVDTKDILFICGGAFVDLEKTIAERRQASSIGFG 2
LK++EGT +VP +G RKHP+ +++QVDT +ILFICGGAF L+K IA+R Q SIGFG
Sbjct: 212 LKLMEGTTASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLDKIIADRLQKRSIGFG 270


>sp|Q3J1G7|CLPX_RHOS4 ATP-dependent Clp protease ATP-binding subunit
clpX OS=Rhodobacter sphaeroides (strain ATCC 17023 /
2.4.1 / NCIB 8253 / DSM 158) GN=clpX PE=3 SV=1
Length = 421

Score = 163 bits (412), Expect = 3e-40
Identities = 79/119 (66%), Positives = 100/119 (84%)
Frame = -1

Query: 358 GYVGEDVESILYKLLTVAELNVPAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQAL 179
GYVGEDVE+I+ KLL +E NV Q+GIVYIDEVDKIT+K+++ +I+RDVSGEGVQQAL
Sbjct: 150 GYVGEDVENIILKLLQASEYNVERVQRGIVYIDEVDKITRKSDNPSITRDVSGEGVQQAL 209

Query: 178 LKMLEGTVVNVPEKGVRKHPRGDYIQVDTKDILFICGGAFVDLEKTIAERRQASSIGFG 2
LK++EGTV +VP +G RKHP+ +++QVDT +ILFICGGAF LEK IA+R + S IGFG
Sbjct: 210 LKIMEGTVASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLEKIIAQRGKGSGIGFG 268


>sp|Q2G3T4|CLPX_NOVAD ATP-dependent Clp protease ATP-binding subunit
clpX OS=Novosphingobium aromaticivorans (strain DSM
12444) GN=clpX PE=3 SV=1
Length = 418

Score = 163 bits (412), Expect = 3e-40
Identities = 79/119 (66%), Positives = 99/119 (83%)
Frame = -1

Query: 358 GYVGEDVESILYKLLTVAELNVPAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQAL 179
GYVGEDVE+I+ KLL ++ NV AQ GIVYIDE+DKI++KAE+ +I+RDVSGEGVQQAL
Sbjct: 152 GYVGEDVENIILKLLQASDYNVEKAQHGIVYIDEIDKISRKAENPSITRDVSGEGVQQAL 211

Query: 178 LKMLEGTVVNVPEKGVRKHPRGDYIQVDTKDILFICGGAFVDLEKTIAERRQASSIGFG 2
LK++EGT +VP +G RKHP+ +++QVDT +ILFICGGAF LEK IA+R Q SIGFG
Sbjct: 212 LKLMEGTTASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLEKIIADRLQKRSIGFG 270


>sp|Q8YQX7|CLPX_ANASP ATP-dependent Clp protease ATP-binding subunit
clpX OS=Anabaena sp. (strain PCC 7120) GN=clpX PE=3 SV=1
Length = 445

Score = 163 bits (412), Expect = 3e-40
Identities = 81/118 (68%), Positives = 98/118 (83%)
Frame = -1

Query: 358 GYVGEDVESILYKLLTVAELNVPAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQAL 179
GYVGEDVE+IL +LL VA+L+V AQ+GI+YIDE+DKI +K+E+ +I+RDVSGEGVQQAL
Sbjct: 174 GYVGEDVENILLRLLQVADLDVEEAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQAL 233

Query: 178 LKMLEGTVVNVPEKGVRKHPRGDYIQVDTKDILFICGGAFVDLEKTIAERRQASSIGF 5
LKMLEGTV NVP +G RKHP D IQ+DT +ILFICGGAFV LEK + +R SIGF
Sbjct: 234 LKMLEGTVANVPPQGGRKHPYQDCIQIDTSNILFICGGAFVGLEKVVDQRGGKKSIGF 291


>sp|Q28NI8|CLPX_JANSC ATP-dependent Clp protease ATP-binding subunit
clpX OS=Jannaschia sp. (strain CCS1) GN=clpX PE=3 SV=1
Length = 421

Score = 162 bits (411), Expect = 4e-40
Identities = 78/119 (65%), Positives = 102/119 (85%)
Frame = -1

Query: 358 GYVGEDVESILYKLLTVAELNVPAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQAL 179
GYVGEDVE+I+ KLL +E NV AQ+GIVYIDEVDKIT+K+++ +I+RDVSGEGVQQAL
Sbjct: 150 GYVGEDVENIILKLLQASEYNVERAQRGIVYIDEVDKITRKSDNPSITRDVSGEGVQQAL 209

Query: 178 LKMLEGTVVNVPEKGVRKHPRGDYIQVDTKDILFICGGAFVDLEKTIAERRQASSIGFG 2
LK++EGTV +VP +G RKHP+ +++QVDT +ILFICGGAF L+K IA+R + S++GFG
Sbjct: 210 LKIMEGTVASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLDKIIAQRGKGSAMGFG 268


>sp|Q3M727|CLPX_ANAVT ATP-dependent Clp protease ATP-binding subunit
clpX OS=Anabaena variabilis (strain ATCC 29413 / PCC
7937) GN=clpX PE=3 SV=1
Length = 446

Score = 162 bits (411), Expect = 4e-40
Identities = 80/118 (67%), Positives = 98/118 (83%)
Frame = -1

Query: 358 GYVGEDVESILYKLLTVAELNVPAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQAL 179
GYVGEDVE+IL +LL VA+L+V AQ+GI+YIDE+DKI +K+E+ +I+RDVSGEGVQQAL
Sbjct: 175 GYVGEDVENILLRLLQVADLDVEEAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQAL 234

Query: 178 LKMLEGTVVNVPEKGVRKHPRGDYIQVDTKDILFICGGAFVDLEKTIAERRQASSIGF 5
LKMLEGT+ NVP +G RKHP D IQ+DT +ILFICGGAFV LEK + +R SIGF
Sbjct: 235 LKMLEGTIANVPPQGGRKHPYQDCIQIDTSNILFICGGAFVGLEKVVDQRGGKKSIGF 292


tr_hit_id A9T4I1
Definition tr|A9T4I1|A9T4I1_PHYPA Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens
Align length 119
Score (bit) 218.0
E-value 2.0e-55
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP915867|Adiantum capillus-veneris mRNA, clone:
YMU001_000078_E11.
(358 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9T4I1|A9T4I1_PHYPA Predicted protein (Fragment) OS=Physcomit... 218 2e-55
tr|B4FR53|B4FR53_MAIZE Putative uncharacterized protein OS=Zea m... 216 6e-55
tr|A7Q7Q4|A7Q7Q4_VITVI Chromosome chr18 scaffold_61, whole genom... 214 2e-54
tr|Q9FK07|Q9FK07_ARATH ATP-dependent Clp protease regulatory sub... 214 2e-54
tr|A9T632|A9T632_PHYPA Predicted protein (Fragment) OS=Physcomit... 214 2e-54
tr|B8ADZ4|B8ADZ4_ORYSI Putative uncharacterized protein OS=Oryza... 213 3e-54
tr|B7FAD8|B7FAD8_ORYSJ cDNA, clone: J100065N04, full insert sequ... 213 3e-54
tr|A5BYR3|A5BYR3_VITVI Putative uncharacterized protein OS=Vitis... 213 4e-54
tr|Q9C874|Q9C874_ARATH CLP protease regulatory subunit CLPX, put... 211 1e-53
tr|Q9C814|Q9C814_ARATH CLP protease regulatory subunit CLPX, put... 211 1e-53
tr|Q66GN9|Q66GN9_ARATH At1g33360 OS=Arabidopsis thaliana GN=At1g... 211 1e-53
tr|O48566|O48566_ARATH CLP protease regulatory subunit CLPX OS=A... 211 2e-53
tr|A9SNL6|A9SNL6_PHYPA Predicted protein (Fragment) OS=Physcomit... 209 7e-53
tr|Q6Z7F0|Q6Z7F0_ORYSJ Putative ATP-dependent Clp protease ATP-b... 206 4e-52
tr|A5AH95|A5AH95_VITVI Putative uncharacterized protein OS=Vitis... 204 1e-51
tr|Q6KAC2|Q6KAC2_ORYSJ Putative ATP-dependent Clp protease ATP-b... 202 5e-51
tr|B6SSC5|B6SSC5_MAIZE ATP-dependent Clp protease ATP-binding su... 202 5e-51
tr|A3A5S6|A3A5S6_ORYSJ Putative uncharacterized protein OS=Oryza... 202 5e-51
tr|B8A7C1|B8A7C1_ORYSI Putative uncharacterized protein OS=Oryza... 198 1e-49
tr|Q5N8G6|Q5N8G6_ORYSJ Putative CLP protease regulatory subunit ... 196 4e-49
tr|A7QF37|A7QF37_VITVI Chromosome chr16 scaffold_86, whole genom... 196 4e-49
tr|A3A0B9|A3A0B9_ORYSJ Putative uncharacterized protein OS=Oryza... 196 4e-49
tr|Q0E1X4|Q0E1X4_ORYSJ Os02g0293500 protein OS=Oryza sativa subs... 193 4e-48
tr|A6MGZ7|A6MGZ7_LILLO ATP-dependent Clp protease regulatory sub... 192 9e-48
tr|Q0E0B4|Q0E0B4_ORYSJ Os02g0564400 protein OS=Oryza sativa subs... 184 1e-45
tr|A3A837|A3A837_ORYSJ Putative uncharacterized protein OS=Oryza... 184 1e-45
tr|A5AWV1|A5AWV1_VITVI Putative uncharacterized protein OS=Vitis... 183 3e-45
tr|A7QCD6|A7QCD6_VITVI Chromosome undetermined scaffold_77, whol... 174 2e-42
tr|Q9LTA9|Q9LTA9_ARATH CLP protease regulatory subunit CLPX-like... 174 3e-42
tr|A8J8T9|A8J8T9_CHLRE ATP-dependent clp protease ATP-binding su... 172 6e-42

>tr|A9T4I1|A9T4I1_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_12072 PE=4 SV=1
Length = 433

Score = 218 bits (554), Expect = 2e-55
Identities = 109/119 (91%), Positives = 114/119 (95%)
Frame = -1

Query: 358 GYVGEDVESILYKLLTVAELNVPAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQAL 179
GYVGEDVESILYKLL AE NVPAAQQGIVYIDEVDKITKKAE++NISRDVSGEGVQQAL
Sbjct: 144 GYVGEDVESILYKLLMAAEFNVPAAQQGIVYIDEVDKITKKAENMNISRDVSGEGVQQAL 203

Query: 178 LKMLEGTVVNVPEKGVRKHPRGDYIQVDTKDILFICGGAFVDLEKTIAERRQASSIGFG 2
LKMLEGTVVNVPEKG RKHPRGD+IQVDTKDILFICGGAF++LEKTIAERRQ SSIGFG
Sbjct: 204 LKMLEGTVVNVPEKGARKHPRGDHIQVDTKDILFICGGAFIELEKTIAERRQDSSIGFG 262


>tr|B4FR53|B4FR53_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 346

Score = 216 bits (549), Expect = 6e-55
Identities = 108/119 (90%), Positives = 114/119 (95%)
Frame = -1

Query: 358 GYVGEDVESILYKLLTVAELNVPAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQAL 179
GYVGEDVESILYKLLTVA+ NV AAQQG+VYIDEVDKITKKAES+NISRDVSGEGVQQAL
Sbjct: 35 GYVGEDVESILYKLLTVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQAL 94

Query: 178 LKMLEGTVVNVPEKGVRKHPRGDYIQVDTKDILFICGGAFVDLEKTIAERRQASSIGFG 2
LKMLEGT+VNVPEKG RKHPRGD IQ+DTKDILFICGGAFVDLEKTI+ERRQ SSIGFG
Sbjct: 95 LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISERRQDSSIGFG 153


>tr|A7Q7Q4|A7Q7Q4_VITVI Chromosome chr18 scaffold_61, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00031954001
PE=4 SV=1
Length = 595

Score = 214 bits (545), Expect = 2e-54
Identities = 107/119 (89%), Positives = 114/119 (95%)
Frame = -1

Query: 358 GYVGEDVESILYKLLTVAELNVPAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQAL 179
GYVGEDVESILYKLLTVAE NV AAQQG+VYIDEVDKITKKAES+N+SRDVSGEGVQQAL
Sbjct: 361 GYVGEDVESILYKLLTVAEFNVQAAQQGMVYIDEVDKITKKAESLNLSRDVSGEGVQQAL 420

Query: 178 LKMLEGTVVNVPEKGVRKHPRGDYIQVDTKDILFICGGAFVDLEKTIAERRQASSIGFG 2
LKMLEGTV+NVPEKG RKHPRGD IQ+DTKDILFICGGAFVDLEKTI++RRQ SSIGFG
Sbjct: 421 LKMLEGTVMNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDLEKTISDRRQDSSIGFG 479


>tr|Q9FK07|Q9FK07_ARATH ATP-dependent Clp protease regulatory
subunit CLPX (Putative ATP-dependent Clp protease
ATP-binding subunit ClpX1) OS=Arabidopsis thaliana
GN=At5g53350 PE=2 SV=1
Length = 579

Score = 214 bits (544), Expect = 2e-54
Identities = 107/119 (89%), Positives = 113/119 (94%)
Frame = -1

Query: 358 GYVGEDVESILYKLLTVAELNVPAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQAL 179
GYVGEDVESILYKLLTVA+ NV AAQQGIVYIDEVDKITKKAES+NISRDVSGEGVQQAL
Sbjct: 263 GYVGEDVESILYKLLTVADYNVAAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL 322

Query: 178 LKMLEGTVVNVPEKGVRKHPRGDYIQVDTKDILFICGGAFVDLEKTIAERRQASSIGFG 2
LKMLEGT+VNVPEKG RKHPRGD IQ+DTKDILFICGGAFVD+EKTI+ERR SSIGFG
Sbjct: 323 LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFVDIEKTISERRHDSSIGFG 381


>tr|A9T632|A9T632_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_11431 PE=4 SV=1
Length = 392

Score = 214 bits (544), Expect = 2e-54
Identities = 105/119 (88%), Positives = 114/119 (95%)
Frame = -1

Query: 358 GYVGEDVESILYKLLTVAELNVPAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQAL 179
GYVGEDVESILYKLL V+E NVPAAQQGIVYIDEVDKITKKAESV+ISRDVSGEGVQQAL
Sbjct: 104 GYVGEDVESILYKLLMVSEFNVPAAQQGIVYIDEVDKITKKAESVSISRDVSGEGVQQAL 163

Query: 178 LKMLEGTVVNVPEKGVRKHPRGDYIQVDTKDILFICGGAFVDLEKTIAERRQASSIGFG 2
LKMLEGT+VNVPEKG RKHPRGD+IQ+DTKDILFICGGAF++L KT+AER+Q SSIGFG
Sbjct: 164 LKMLEGTIVNVPEKGARKHPRGDHIQIDTKDILFICGGAFIELAKTVAERKQDSSIGFG 222


>tr|B8ADZ4|B8ADZ4_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_07697 PE=4 SV=1
Length = 645

Score = 213 bits (543), Expect = 3e-54
Identities = 106/119 (89%), Positives = 113/119 (94%)
Frame = -1

Query: 358 GYVGEDVESILYKLLTVAELNVPAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQAL 179
GYVGEDVESILYKLL VA+ NV AAQQG+VYIDEVDKITKKAES+NISRDVSGEGVQQAL
Sbjct: 334 GYVGEDVESILYKLLAVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQAL 393

Query: 178 LKMLEGTVVNVPEKGVRKHPRGDYIQVDTKDILFICGGAFVDLEKTIAERRQASSIGFG 2
LKMLEGT+VNVPEKG RKHPRGD IQ+DTKDILFICGGAF+DLEKTI+ERRQ SSIGFG
Sbjct: 394 LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFG 452


>tr|B7FAD8|B7FAD8_ORYSJ cDNA, clone: J100065N04, full insert
sequence OS=Oryza sativa subsp. japonica PE=2 SV=1
Length = 645

Score = 213 bits (543), Expect = 3e-54
Identities = 106/119 (89%), Positives = 113/119 (94%)
Frame = -1

Query: 358 GYVGEDVESILYKLLTVAELNVPAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQAL 179
GYVGEDVESILYKLL VA+ NV AAQQG+VYIDEVDKITKKAES+NISRDVSGEGVQQAL
Sbjct: 334 GYVGEDVESILYKLLAVADFNVQAAQQGMVYIDEVDKITKKAESLNISRDVSGEGVQQAL 393

Query: 178 LKMLEGTVVNVPEKGVRKHPRGDYIQVDTKDILFICGGAFVDLEKTIAERRQASSIGFG 2
LKMLEGT+VNVPEKG RKHPRGD IQ+DTKDILFICGGAF+DLEKTI+ERRQ SSIGFG
Sbjct: 394 LKMLEGTIVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFG 452


>tr|A5BYR3|A5BYR3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_040753 PE=4 SV=1
Length = 600

Score = 213 bits (542), Expect = 4e-54
Identities = 107/119 (89%), Positives = 113/119 (94%)
Frame = -1

Query: 358 GYVGEDVESILYKLLTVAELNVPAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQAL 179
GYVGEDVESILYKLL VA+ NV AAQQGIVYIDEVDKITKKAES+N+SRDVSGEGVQQAL
Sbjct: 285 GYVGEDVESILYKLLMVADYNVVAAQQGIVYIDEVDKITKKAESLNLSRDVSGEGVQQAL 344

Query: 178 LKMLEGTVVNVPEKGVRKHPRGDYIQVDTKDILFICGGAFVDLEKTIAERRQASSIGFG 2
LKMLEGTVVNVPEKG RKHPRGD IQ+DTKDILFICGGAF+DLEKTI+ERRQ SSIGFG
Sbjct: 345 LKMLEGTVVNVPEKGARKHPRGDNIQIDTKDILFICGGAFIDLEKTISERRQDSSIGFG 403


>tr|Q9C874|Q9C874_ARATH CLP protease regulatory subunit CLPX,
putative OS=Arabidopsis thaliana GN=T16O9.5 PE=4 SV=1
Length = 650

Score = 211 bits (537), Expect = 1e-53
Identities = 105/119 (88%), Positives = 113/119 (94%)
Frame = -1

Query: 358 GYVGEDVESILYKLLTVAELNVPAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQAL 179
GYVG+DVESIL+KLLTVAE NV AAQQGIVYIDEVDKITKKAES+NISRDVSGEGVQQAL
Sbjct: 354 GYVGDDVESILHKLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL 413

Query: 178 LKMLEGTVVNVPEKGVRKHPRGDYIQVDTKDILFICGGAFVDLEKTIAERRQASSIGFG 2
LK+LEGT+VNVP KG RKHPRGD+IQ+DTKDILFICGGAFVDLEKTI +RRQ SSIGFG
Sbjct: 414 LKLLEGTIVNVPGKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDRRQDSSIGFG 472


>tr|Q9C814|Q9C814_ARATH CLP protease regulatory subunit CLPX,
putative; 15869-19379 OS=Arabidopsis thaliana
GN=F10C21.5 PE=4 SV=1
Length = 670

Score = 211 bits (537), Expect = 1e-53
Identities = 105/119 (88%), Positives = 113/119 (94%)
Frame = -1

Query: 358 GYVGEDVESILYKLLTVAELNVPAAQQGIVYIDEVDKITKKAESVNISRDVSGEGVQQAL 179
GYVG+DVESIL+KLLTVAE NV AAQQGIVYIDEVDKITKKAES+NISRDVSGEGVQQAL
Sbjct: 374 GYVGDDVESILHKLLTVAEFNVQAAQQGIVYIDEVDKITKKAESLNISRDVSGEGVQQAL 433

Query: 178 LKMLEGTVVNVPEKGVRKHPRGDYIQVDTKDILFICGGAFVDLEKTIAERRQASSIGFG 2
LK+LEGT+VNVP KG RKHPRGD+IQ+DTKDILFICGGAFVDLEKTI +RRQ SSIGFG
Sbjct: 434 LKLLEGTIVNVPGKGARKHPRGDHIQIDTKDILFICGGAFVDLEKTIVDRRQDSSIGFG 492