BP919758
Clone id YMU001_000128_G08
Library
Length 511
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000128_G08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTTCTGTGCTTCCCTTGGCCCTCCCAAGCTGGGATTGGTCTGTGTTTCATCCAATTTTAT
CGACTCAGTGCGCTCAAGCATCTGTTCTGTATTGACTCGTGCAAGTCTCTCTGGGTCCAC
AATCTCTTGCGGGCCTTGATTGGCTGTCTTGTCTCTCTCTTGCCCCTGACTGATAAGCTC
CCACTCTCCCATTGAAGCTGGGCTTGTTGACTCTTCCTTATTTCCTTCTGCAGACACCTC
TTTCTTCAAATCATCATCTTGCTCCTTCTCGCTCTCTTTTTCAGCACTACTATCAATATC
TTGTGTTGCGTCACCTAAGGTTCTCTCCACCGCTTGCCGAAAGCCACTCTCTTTCTTTTG
TTTTGGAGGAGTTTCTTTTGCAAATTGAAGCCAAGCATCATCCAGCTTGTCCTCCACATG
GGCAGGCGCAGTTGCAAGTGCAAAGAAAAATCCACCATCATCCACGTCTTTATCAATGGG
GAACTGTGCAAGAATTTCTTGATCCTCATCA
■■Homology search results ■■ -
sp_hit_id Q12176
Definition sp|Q12176|MAK21_YEAST Ribosome biogenesis protein MAK21 OS=Saccharomyces cerevisiae
Align length 141
Score (bit) 42.4
E-value 0.001
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919758|Adiantum capillus-veneris mRNA, clone:
YMU001_000128_G08.
(511 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q12176|MAK21_YEAST Ribosome biogenesis protein MAK21 OS=Sacch... 42 0.001
sp|Q54LY8|Y6915_DICDI Uncharacterized protein DDB_G0286299 OS=Di... 41 0.004
sp|Q55FI4|NOL5_DICDI Nucleolar protein 5 OS=Dictyostelium discoi... 40 0.005
sp|Q9UH65|SWP70_HUMAN Switch-associated protein 70 OS=Homo sapie... 40 0.006
sp|P02547|NFL_PIG Neurofilament light polypeptide OS=Sus scrofa ... 40 0.008
sp|P0C1G6|SWP70_BOVIN Switch-associated protein 70 OS=Bos taurus... 39 0.014
sp|O77033|CYC8_DICDI General transcriptional corepressor trfA OS... 39 0.014
sp|Q54J55|MYBX_DICDI Myb-like protein X OS=Dictyostelium discoid... 39 0.018
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1... 39 0.018
sp|Q869E1|DNLI1_DICDI DNA ligase 1 OS=Dictyostelium discoideum G... 39 0.018
sp|P34618|CEC1_CAEEL Chromo domain-containing protein cec-1 OS=C... 38 0.024
sp|Q54W06|Y5261_DICDI Uncharacterized protein DDB_G0279979 OS=Di... 38 0.031
sp|Q53RK8|RH21_ORYSJ DEAD-box ATP-dependent RNA helicase 21 OS=O... 37 0.054
sp|Q6A028|SWP70_MOUSE Switch-associated protein 70 OS=Mus muscul... 37 0.070
sp|Q0V3R6|SEC16_PHANO COPII coat assembly protein SEC16 OS=Phaeo... 37 0.070
sp|Q17336|NCM_CAEEL Nucampholin OS=Caenorhabditis elegans GN=let... 36 0.091
sp|Q5ZKT9|MIER1_CHICK Mesoderm induction early response protein ... 36 0.091
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=... 36 0.091
sp|Q9HGI4|ERF3_ZYGRO Eukaryotic peptide chain release factor GTP... 36 0.091
sp|P35662|CYLC1_BOVIN Cylicin-1 OS=Bos taurus GN=CYLC1 PE=1 SV=1 36 0.091
sp|P10645|CMGA_HUMAN Chromogranin-A OS=Homo sapiens GN=CHGA PE=1... 36 0.091
sp|A6QNW6|S26A8_BOVIN Testis anion transporter 1 OS=Bos taurus G... 36 0.12
sp|Q6QA27|TRI44_RAT Tripartite motif-containing protein 44 OS=Ra... 35 0.16
sp|Q05D44|IF2P_MOUSE Eukaryotic translation initiation factor 5B... 35 0.16
sp|Q8NE71|ABCF1_HUMAN ATP-binding cassette sub-family F member 1... 35 0.16
sp|Q54PM6|Y8605_DICDI Uncharacterized protein DDB_G0284459 OS=Di... 35 0.20
sp|P08199|NUCL_MESAU Nucleolin OS=Mesocricetus auratus GN=NCL PE... 35 0.20
sp|Q6C2Q7|NOP12_YARLI Nucleolar protein 12 OS=Yarrowia lipolytic... 35 0.20
sp|P12957|CALD1_CHICK Caldesmon OS=Gallus gallus GN=CALD1 PE=1 SV=2 35 0.20
sp|A2VD23|STM_DANRE Protein starmaker OS=Danio rerio GN=stm PE=2... 35 0.27

>sp|Q12176|MAK21_YEAST Ribosome biogenesis protein MAK21
OS=Saccharomyces cerevisiae GN=MAK21 PE=1 SV=1
Length = 1025

Score = 42.4 bits (98), Expect = 0.001
Identities = 32/141 (22%), Positives = 62/141 (43%), Gaps = 2/141 (1%)
Frame = -2

Query: 489 AQFPIDKDVDDGGFFFALATAPAHVEDKLDDAWLQFAKETPPKQKKESGFRQAVERTLGD 310
+ F D ++D+ + AL + VED DD+ L FA++ + + D
Sbjct: 874 SNFDSDDEMDENEIWSALVKSRPDVEDDSDDSELDFAEDDFSDSTSD-------DEPKLD 926

Query: 309 ATQDIDSSAEKESEKEQDDDLKKEV--SAEGNKEESTSPASMGEWELISQGQERDKTANQ 136
A D D+ +E E +Q++ L +++ S +G ++ S S E + E +K +
Sbjct: 927 AIDDEDAKSEGSQESDQEEGLDEDIFYSFDGEQDNSDKKRSFAESSEEDESSEEEKEEEE 986

Query: 135 GPQEIVDPERLARVNTEQMLE 73
+ V +R + + ML+
Sbjct: 987 NKE--VSAKRAKKKQRKNMLK 1005


>sp|Q54LY8|Y6915_DICDI Uncharacterized protein DDB_G0286299
OS=Dictyostelium discoideum GN=DDB_G0286299 PE=4 SV=1
Length = 451

Score = 40.8 bits (94), Expect = 0.004
Identities = 30/126 (23%), Positives = 61/126 (48%)
Frame = -2

Query: 378 KETPPKQKKESGFRQAVERTLGDATQDIDSSAEKESEKEQDDDLKKEVSAEGNKEESTSP 199
KE PK+ KE +A ++ + +D D E++ EKE+D++ K+E S E + EES
Sbjct: 87 KEKEPKEPKEPK-EKAKKKAKTEKKKD-DGDEEEDEEKEEDEEQKEEQSQEEDSEESEEE 144

Query: 198 ASMGEWELISQGQERDKTANQGPQEIVDPERLARVNTEQMLERTESIKLDETQTNPSLGG 19
+ E +++ K A + ++ +P++ ++ + E+ K ++ T S
Sbjct: 145 QNSDE-----DKKKKKKQAKKVAKKETEPKKKEAKPKKEAKPKKETTKKEKEATTTSSDS 199

Query: 18 PREAQK 1
+ +K
Sbjct: 200 TEKKEK 205


>sp|Q55FI4|NOL5_DICDI Nucleolar protein 5 OS=Dictyostelium
discoideum GN=nol5 PE=3 SV=1
Length = 638

Score = 40.4 bits (93), Expect = 0.005
Identities = 30/126 (23%), Positives = 61/126 (48%), Gaps = 6/126 (4%)
Frame = -2

Query: 399 DAWLQFAKETPPKQKKESGFRQAVERTLGDATQDIDSSAE------KESEKEQDDDLKKE 238
D + +KE+ KQ+K+ + + D++ D DSS E K+S+KE+ K+E
Sbjct: 436 DVATKSSKESSIKQEKQDVKMEEASSSDSDSSSDSDSSEEEKSKKSKKSKKEETPVAKEE 495

Query: 237 VSAEGNKEESTSPASMGEWELISQGQERDKTANQGPQEIVDPERLARVNTEQMLERTESI 58
+ +K+E T A + E + +++DK + +E E+ + + ++ E T
Sbjct: 496 KKEKKSKKEETPVAKEEKKEKEEKKEKKDKKEKKEEKEDKKEEKKEKKDKKEKTEETPVA 555

Query: 57 KLDETQ 40
K ++ +
Sbjct: 556 KEEKKE 561



Score = 30.4 bits (67), Expect = 5.0
Identities = 21/118 (17%), Positives = 54/118 (45%), Gaps = 5/118 (4%)
Frame = -2

Query: 378 KETP-----PKQKKESGFRQAVERTLGDATQDIDSSAEKESEKEQDDDLKKEVSAEGNKE 214
+ETP K+KK V + ++ +K+ +KE+ +D K+E + +K+
Sbjct: 487 EETPVAKEEKKEKKSKKEETPVAKEEKKEKEEKKEKKDKKEKKEEKEDKKEEKKEKKDKK 546

Query: 213 ESTSPASMGEWELISQGQERDKTANQGPQEIVDPERLARVNTEQMLERTESIKLDETQ 40
E T + + E + +++++ + ++ ++ + ++ E+ S K D+ +
Sbjct: 547 EKTEETPVAKEEKKEKKEKKEEKEEKKDKKEKKEKKEEKEEKKEKKEKKSSSKEDKKE 604


>sp|Q9UH65|SWP70_HUMAN Switch-associated protein 70 OS=Homo sapiens
GN=SWAP70 PE=1 SV=1
Length = 585

Score = 40.0 bits (92), Expect = 0.006
Identities = 27/116 (23%), Positives = 55/116 (47%)
Frame = -2

Query: 387 QFAKETPPKQKKESGFRQAVERTLGDATQDIDSSAEKESEKEQDDDLKKEVSAEGNKEES 208
Q ++ K + + Q V R L D + + E E + QD++ +++ A +EES
Sbjct: 400 QMEEQVAQKSSELEQYLQRV-RELEDMYLKLQEALEDERQARQDEETVRKLQARLLEEES 458

Query: 207 TSPASMGEWELISQGQERDKTANQGPQEIVDPERLARVNTEQMLERTESIKLDETQ 40
+ A + +W L + Q+ +T QE+ + L ++ +E+ E ++L+ Q
Sbjct: 459 SKRAELEKWHL--EQQQAIQTTEAEKQELENQRVLKEQALQEAMEQLEQLELERKQ 512


>sp|P02547|NFL_PIG Neurofilament light polypeptide OS=Sus scrofa
GN=NEFL PE=1 SV=3
Length = 549

Score = 39.7 bits (91), Expect = 0.008
Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 2/90 (2%)
Frame = -2

Query: 417 VEDKLDDAWLQFAKETPPKQ--KKESGFRQAVERTLGDATQDIDSSAEKESEKEQDDDLK 244
VE+ ++ A + AK+ PP + +E G + +A ++ E+ +EKE+ ++ K
Sbjct: 454 VEETIEAAKAEEAKDEPPSEGEAEEEGKEKEEAEAEAEAEEEGAQEEEEAAEKEESEEAK 513

Query: 243 KEVSAEGNKEESTSPASMGEWELISQGQER 154
+E EG + E T A E + G+E+
Sbjct: 514 EEEGGEGEQGEETKEAEEEEKKDEGAGEEQ 543


>sp|P0C1G6|SWP70_BOVIN Switch-associated protein 70 OS=Bos taurus
GN=SWAP70 PE=1 SV=1
Length = 585

Score = 38.9 bits (89), Expect = 0.014
Identities = 26/116 (22%), Positives = 55/116 (47%)
Frame = -2

Query: 387 QFAKETPPKQKKESGFRQAVERTLGDATQDIDSSAEKESEKEQDDDLKKEVSAEGNKEES 208
Q ++ K + + Q V R L D + + E E + QD++ +++ A +EES
Sbjct: 400 QMEEQVAQKSSELEQYLQRV-RELEDMYLKLQEALEDERQARQDEETVRKLQARLLEEES 458

Query: 207 TSPASMGEWELISQGQERDKTANQGPQEIVDPERLARVNTEQMLERTESIKLDETQ 40
+ A + +W L + Q+ +T QE+ + + ++ LE+ + ++L+ Q
Sbjct: 459 SKRAELEKWHL--EQQQAIQTTEAEKQELENQRVIKEQALQEALEQLQQLELERKQ 512


>sp|O77033|CYC8_DICDI General transcriptional corepressor trfA
OS=Dictyostelium discoideum GN=trfA PE=2 SV=1
Length = 1390

Score = 38.9 bits (89), Expect = 0.014
Identities = 31/124 (25%), Positives = 61/124 (49%), Gaps = 11/124 (8%)
Frame = -2

Query: 387 QFAKETPPKQKKESGFRQAVERTLGDATQDIDSSAEKESEKEQDDDLKKEVSAEGNKE-- 214
+ KET +++KE + VE+ + ++I++ EKE EKE + D+++ S E + E
Sbjct: 1038 EIEKETEKEKEKEKEKEKEVEK---EVEKEIENDKEKEKEKEVEKDVEENKSVEKSSEKP 1094

Query: 213 ---ESTSPASMGEWELISQGQERDKTANQGPQEI-VDPERLARVN-----TEQMLERTES 61
EST+ + E E + T ++ D ++L+ V+ EQ + T+
Sbjct: 1095 VEKESTTTTTNDEDEEGELSEPTTTTKKDDSSKLPTDEKKLSSVSPTTTAVEQSRDETKE 1154

Query: 60 IKLD 49
+++D
Sbjct: 1155 LEMD 1158



Score = 33.9 bits (76), Expect = 0.45
Identities = 29/129 (22%), Positives = 57/129 (44%), Gaps = 12/129 (9%)
Frame = -2

Query: 378 KETPPKQKKESGFRQAVER-------TLGDATQDIDSSAEKESEKEQDDDLKKEVSAEGN 220
K+ KES + V++ + ++++I+ EKE EKE++ + KEV E
Sbjct: 1005 KQVEKVTDKESSLVEKVDKENEKESPSSSSSSKEIEKETEKEKEKEKEKE--KEVEKEVE 1062

Query: 219 KEESTSPASMGEWELISQGQERDKTANQGPQEIVDPERLARVNTE-----QMLERTESIK 55
KE E E + + E +K+ + ++ V+ E + ++ E T + K
Sbjct: 1063 KEIENDKEKEKEKE-VEKDVEENKSVEKSSEKPVEKESTTTTTNDEDEEGELSEPTTTTK 1121

Query: 54 LDETQTNPS 28
D++ P+
Sbjct: 1122 KDDSSKLPT 1130


>sp|Q54J55|MYBX_DICDI Myb-like protein X OS=Dictyostelium discoideum
GN=mybX PE=3 SV=1
Length = 1620

Score = 38.5 bits (88), Expect = 0.018
Identities = 38/143 (26%), Positives = 66/143 (46%), Gaps = 4/143 (2%)
Frame = -2

Query: 420 HVEDKLDDAWLQFAKETPPKQKKESGFRQAVERTL---GDATQDIDSSAEKESEKEQDDD 250
H E++ D + KE + K E+G + E+ + + ++ EKE+E E++++
Sbjct: 675 HNENEKQDKDKENEKEK--EDKTENGNEKENEKENEKENEKENEKENENEKENENEKENE 732

Query: 249 LKKEVSAEGNKEESTSPASMGEWELISQGQERDKTANQGPQEIVDPERLARVNTEQMLER 70
KKE E KE E E + + E DK E +D E+ ++N ++ E
Sbjct: 733 NKKEKEKENKKENE------NENEKVDEKIEIDK-EGINEDEKMDEEKEEKINNKKEDEE 785

Query: 69 TES-IKLDETQTNPSLGGPREAQ 4
ES IK D+ + N + G E +
Sbjct: 786 VESEIKKDKLKENEEVEGEIEGE 808



Score = 35.4 bits (80), Expect = 0.16
Identities = 24/115 (20%), Positives = 52/115 (45%)
Frame = -2

Query: 378 KETPPKQKKESGFRQAVERTLGDATQDIDSSAEKESEKEQDDDLKKEVSAEGNKEESTSP 199
+E K++KE ++ ER + Q+ + EKE ++E ++ +KE + KEE
Sbjct: 467 EEKQEKEEKERLEKEEKERLEREEKQEKEEKEEKEEKEENEEKEEKEEKEKEEKEEK--- 523

Query: 198 ASMGEWELISQGQERDKTANQGPQEIVDPERLARVNTEQMLERTESIKLDETQTN 34
E + +++K N+ QE ++ + + + ++ K + T +N
Sbjct: 524 ------EKQEKEDDKEKQENENEQEKIEKKENKNDSQNKEIKENHDKKDETTDSN 572



Score = 33.9 bits (76), Expect = 0.45
Identities = 30/130 (23%), Positives = 55/130 (42%), Gaps = 15/130 (11%)
Frame = -2

Query: 381 AKETPPKQKKESGFRQAVERTLGDATQDIDSSAEKESEKEQDDDLK-------------- 244
AK+ K+K+E +Q E+ Q+ D +K+ EKE++ + K
Sbjct: 1112 AKDKVDKEKEEDKQKQDKEKEEDKEKQEKDKEEDKDKEKEENKEDKEKEGTDKEGKDKED 1171

Query: 243 KEVSAEGNKEESTSPASMGEWELISQGQERDKTANQGPQEIVDPERLARVNTEQM-LERT 67
KE+ + KEE A +G+ + + T EI + N E + + +
Sbjct: 1172 KEIKEDKEKEEKDKEA-IGDHD----KSDSTNTTTTKEMEIEKQDSSTSTNKETVEMNQD 1226

Query: 66 ESIKLDETQT 37
+ +K+DE +T
Sbjct: 1227 DHVKIDEKET 1236



Score = 30.8 bits (68), Expect = 3.8
Identities = 22/111 (19%), Positives = 51/111 (45%)
Frame = -2

Query: 378 KETPPKQKKESGFRQAVERTLGDATQDIDSSAEKESEKEQDDDLKKEVSAEGNKEESTSP 199
KE K+ KE ++ + D ++ + ++ +KE+++D + + + KEE
Sbjct: 1067 KEDKEKELKEKESKEKELKEKDDKEKEKEKELKEREDKEKEEDKEAKDKVDKEKEEDKQK 1126

Query: 198 ASMGEWELISQGQERDKTANQGPQEIVDPERLARVNTEQMLERTESIKLDE 46
E E + QE+DK ++ ++ + E + T++ + E ++ E
Sbjct: 1127 QDK-EKEEDKEKQEKDKEEDKDKEKEENKEDKEKEGTDKEGKDKEDKEIKE 1176



Score = 29.6 bits (65), Expect = 8.5
Identities = 19/93 (20%), Positives = 40/93 (43%)
Frame = -2

Query: 312 DATQDIDSSAEKESEKEQDDDLKKEVSAEGNKEESTSPASMGEWELISQGQERDKTANQG 133
D ++ +KE+EKE++D + E KE E E ++ + ++ N+
Sbjct: 674 DHNENEKQDKDKENEKEKEDKTENGNEKENEKENEKENEKENEKENENEKENENEKENEN 733

Query: 132 PQEIVDPERLARVNTEQMLERTESIKLDETQTN 34
+E + N + ++ E I++D+ N
Sbjct: 734 KKEKEKENKKENENENEKVD--EKIEIDKEGIN 764


>sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3
SV=2
Length = 5900

Score = 38.5 bits (88), Expect = 0.018
Identities = 31/140 (22%), Positives = 63/140 (45%), Gaps = 9/140 (6%)
Frame = -2

Query: 414 EDKLD-DAWLQFAKETPPKQKKESGFRQAVERTLGDATQDIDSSAEKESEKEQDDDLKKE 238
ED +D D + + KQ+ + + ++ + D + +++ EK+Q D E
Sbjct: 5483 EDDMDVDHKQEVEHQDDSKQQLDENKKISMSKLKQDQLKQQKEKEKEKLEKDQQDGQDDE 5542

Query: 237 VSAEGNKEESTSPASMG------EWELISQG--QERDKTANQGPQEIVDPERLARVNTEQ 82
+ KE+ T E ++ G QE ++ +Q +E V+ ++L R + ++
Sbjct: 5543 LDGLNQKEQFTKEQLENLTNLDKEKAVLDDGDDQEMEQDGDQDDEESVEEKKLTREDLDR 5602

Query: 81 MLERTESIKLDETQTNPSLG 22
M + E K+ E +NP +G
Sbjct: 5603 MRQELEQYKI-ENSSNPEIG 5621



Score = 36.6 bits (83), Expect = 0.070
Identities = 28/112 (25%), Positives = 50/112 (44%)
Frame = -2

Query: 378 KETPPKQKKESGFRQAVERTLGDATQDIDSSAEKESEKEQDDDLKKEVSAEGNKEESTSP 199
KE +Q F+ ++ GD D S E+E +KE D D K+E +G++E+
Sbjct: 5190 KEDDEQQDGGDDFKDPLDEMDGD-----DVSKEEEKKKELDGDEKEESDQDGDEEKEDEE 5244

Query: 198 ASMGEWELISQGQERDKTANQGPQEIVDPERLARVNTEQMLERTESIKLDET 43
G+ + ++++ NQ +DP + +N E E + D+T
Sbjct: 5245 KEDGD-----EDEDKEDKENQP----IDPSNVDSINPEGDEPEKEQPEEDQT 5287



Score = 30.0 bits (66), Expect = 6.5
Identities = 25/100 (25%), Positives = 45/100 (45%), Gaps = 2/100 (2%)
Frame = -2

Query: 339 RQAVERTLGDATQDIDSSAEKESEKEQDDDLKKEVSAEGNKEESTSPASMGEWELISQGQ 160
++ V L D Q D++ +K+ EK++D+D +KE E + GE I + +
Sbjct: 4960 KKDVSDQLEDQGQIEDTNTQKKEEKDEDEDEEKEEKDEDEGFDMQDDFE-GEMHDIKKDE 5018

Query: 159 ERDKTANQGPQEIVDPERLARVNTEQM--LERTESIKLDE 46
+D+ P + N ++M LE+ E +DE
Sbjct: 5019 NKDEDKKDDPNN-------EKENDKEMGDLEKPEDNVVDE 5051


>sp|Q869E1|DNLI1_DICDI DNA ligase 1 OS=Dictyostelium discoideum
GN=lig1 PE=3 SV=1
Length = 1192

Score = 38.5 bits (88), Expect = 0.018
Identities = 29/140 (20%), Positives = 66/140 (47%), Gaps = 10/140 (7%)
Frame = -2

Query: 417 VEDKLDDAWLQFAKETPPKQKKESGFRQAVERTLGDATQDIDSSAEKESEKEQDDDLKKE 238
+E K+ +A +T PK+K+E+ ++ VE+ T+ S++K E+E++++ +++
Sbjct: 20 IEKKISNAQELNKLKTSPKKKREAVVKEKVEKKEKKETKPKRKSSKKNKEEEEEEEQEEQ 79

Query: 237 VSAEGNKEESTSPA----------SMGEWELISQGQERDKTANQGPQEIVDPERLARVNT 88
E +EE E EL +E++K Q + + E + ++
Sbjct: 80 DGEEEQEEEEEYQQQDEEIEEDINGEEEMELDENEKEKNKKKKQSLKTKENKESKSSSSS 139

Query: 87 EQMLERTESIKLDETQTNPS 28
++ +E E+ K ++ + S
Sbjct: 140 KKTIENKETKKPEKQSSKQS 159



Score = 35.0 bits (79), Expect = 0.20
Identities = 23/88 (26%), Positives = 43/88 (48%), Gaps = 1/88 (1%)
Frame = -2

Query: 417 VEDKLDDAWLQFAKETPPKQKKESGFRQAVERTLGDATQDIDSSAEKE-SEKEQDDDLKK 241
++DK + + KE K+KKE ++ ++ + ++ EKE EKE+ + +K
Sbjct: 268 LKDKKEKELKEKEKELKDKEKKEKELKEKEKKEKEEKEKEKKEKKEKELKEKEEKEKKEK 327

Query: 240 EVSAEGNKEESTSPASMGEWELISQGQE 157
E+ + KE+ + E EL S +E
Sbjct: 328 ELKEKELKEKELKEKELKEKELTSPKKE 355



Score = 31.2 bits (69), Expect = 2.9
Identities = 34/148 (22%), Positives = 62/148 (41%), Gaps = 10/148 (6%)
Frame = -2

Query: 414 EDKLDDAWLQFAKETPPKQKKES---GFRQAVERTLGDATQDIDSSAEKE------SEKE 262
E+K DD L + +K+S ++ E+ L D + EKE EKE
Sbjct: 180 ENKTDDNDLDDMLDDDSDNEKDSISSKDKEYKEKVLKDKEKKEKEKKEKELKEKESKEKE 239

Query: 261 QDDDLKKEVSAEGNKEESTSPASMGEWELISQGQERDKTANQGPQEIVDPERLAR-VNTE 85
+ + KKE + KE+ + E EL +++K + +E+ D E+ + + +
Sbjct: 240 KKEKEKKEKEEKDKKEKELKEKELKEKEL---KDKKEKELKEKEKELKDKEKKEKELKEK 296

Query: 84 QMLERTESIKLDETQTNPSLGGPREAQK 1
+ E+ E K + + L E +K
Sbjct: 297 EKKEKEEKEKEKKEKKEKELKEKEEKEK 324


tr_hit_id A9RZ28
Definition tr|A9RZ28|A9RZ28_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 50
Score (bit) 88.6
E-value 2.0e-16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919758|Adiantum capillus-veneris mRNA, clone:
YMU001_000128_G08.
(511 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RZ28|A9RZ28_PHYPA Predicted protein OS=Physcomitrella paten... 89 2e-16
tr|A9RSG0|A9RSG0_PHYPA Predicted protein OS=Physcomitrella paten... 86 8e-16
tr|Q1M320|Q1M320_SOYBN Putative beta-glycosidase OS=Glycine max ... 74 4e-12
tr|Q1M319|Q1M319_SOLLC Putative beta-glycosidase OS=Solanum lyco... 73 7e-12
tr|Q1M317|Q1M317_PINTA Putative beta-glycosidase OS=Pinus taeda ... 73 7e-12
tr|Q9C8Z2|Q9C8Z2_ARATH Beta-glucosidase, putative; 69917-66834 O... 70 5e-11
tr|Q93Y07|Q93Y07_ARATH Beta-glucosidase, putative (Putative beta... 70 5e-11
tr|Q8LGU5|Q8LGU5_ARATH Mutant putative beta-glycosidase OS=Arabi... 70 5e-11
tr|Q8LGU4|Q8LGU4_ARATH Mutant putative beta-glycosidase OS=Arabi... 70 5e-11
tr|Q8LAN2|Q8LAN2_ARATH Beta-glucosidase, putative OS=Arabidopsis... 70 5e-11
tr|Q9SDL5|Q9SDL5_ARATH Beta-glucosidase (Fragment) OS=Arabidopsi... 70 6e-11
tr|A7Q8U3|A7Q8U3_VITVI Chromosome chr5 scaffold_64, whole genome... 67 4e-10
tr|Q8W578|Q8W578_ARATH AT3g06510/F5E6_16 OS=Arabidopsis thaliana... 67 5e-10
tr|Q1M318|Q1M318_MAIZE Putative beta-glycosidase OS=Zea mays GN=... 62 2e-08
tr|A2ZGQ9|A2ZGQ9_ORYSI Putative uncharacterized protein OS=Oryza... 59 1e-07
tr|B8A301|B8A301_MAIZE Putative uncharacterized protein OS=Zea m... 59 2e-07
tr|B6ST01|B6ST01_MAIZE SFR2 OS=Zea mays PE=2 SV=1 59 2e-07
tr|Q8L6H7|Q8L6H7_ORYSJ Glycosyl hydrolase family 1 protein, puta... 58 2e-07
tr|A9UL96|A9UL96_XENTR Putative uncharacterized protein (Fragmen... 45 0.002
tr|B4PK67|B4PK67_DROYA GE20417 OS=Drosophila yakuba GN=GE20417 P... 45 0.002
tr|B6KGQ4|B6KGQ4_TOXGO Putative uncharacterized protein OS=Toxop... 44 0.005
tr|B3LVS0|B3LVS0_DROAN GF18617 OS=Drosophila ananassae GN=GF1861... 44 0.006
tr|B4KYT3|B4KYT3_DROMO GI12447 OS=Drosophila mojavensis GN=GI124... 43 0.008
tr|B3MWM8|B3MWM8_DROAN GF22424 OS=Drosophila ananassae GN=GF2242... 43 0.008
tr|B6L1B3|B6L1B3_BRAFL Putative uncharacterized protein OS=Branc... 42 0.013
tr|B3MDP5|B3MDP5_DROAN GF12953 OS=Drosophila ananassae GN=GF1295... 42 0.013
tr|B5VFV9|B5VFV9_YEAS6 YDR060Wp-like protein OS=Saccharomyces ce... 42 0.013
tr|A6ZY25|A6ZY25_YEAS7 Maintenance of killer OS=Saccharomyces ce... 42 0.013
tr|Q7QC53|Q7QC53_ANOGA AGAP002456-PA OS=Anopheles gambiae GN=AGA... 42 0.018
tr|Q7Q9C0|Q7Q9C0_ANOGA AGAP003331-PA (Fragment) OS=Anopheles gam... 42 0.023

>tr|A9RZ28|A9RZ28_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_121831 PE=3 SV=1
Length = 606

Score = 88.6 bits (218), Expect = 2e-16
Identities = 39/50 (78%), Positives = 46/50 (92%)
Frame = -2

Query: 510 DEDQEILAQFPIDKDVDDGGFFFALATAPAHVEDKLDDAWLQFAKETPPK 361
DE +E+LA+FPIDK+V+DGGFFFALATAPAHVED+LDDAWL+FAK PK
Sbjct: 42 DETKEVLAEFPIDKEVEDGGFFFALATAPAHVEDRLDDAWLEFAKAGEPK 91


>tr|A9RSG0|A9RSG0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_118647 PE=3 SV=1
Length = 636

Score = 86.3 bits (212), Expect = 8e-16
Identities = 46/92 (50%), Positives = 58/92 (63%), Gaps = 2/92 (2%)
Frame = -2

Query: 510 DEDQEILAQFPIDKD--VDDGGFFFALATAPAHVEDKLDDAWLQFAKETPPKQKKESGFR 337
DE +E+LA+FPIDK+ +DGGFFFALATAPAHVEDKLDDAWL+FA+ PK
Sbjct: 42 DESKEVLAEFPIDKEGEFEDGGFFFALATAPAHVEDKLDDAWLEFARAGEPKDNPAG--- 98

Query: 336 QAVERTLGDATQDIDSSAEKESEKEQDDDLKK 241
E G+ S +E+ Q +D+KK
Sbjct: 99 DPPETRTGEKDSAASYSGISLTEEAQAEDIKK 130


>tr|Q1M320|Q1M320_SOYBN Putative beta-glycosidase OS=Glycine max
GN=sfr2 PE=2 SV=1
Length = 637

Score = 73.9 bits (180), Expect = 4e-12
Identities = 44/129 (34%), Positives = 68/129 (52%), Gaps = 10/129 (7%)
Frame = -2

Query: 510 DEDQEILAQFPIDKDVDDGGFFFALATAPAHVEDKLDDAWLQFAKETPPKQKKESGFRQA 331
DE Q+ LA F + + D GFFF LATAPAHVED+LDDAW+QFA++ + +S +Q
Sbjct: 45 DESQDTLAHFNVAEGED--GFFFGLATAPAHVEDRLDDAWIQFAEKKSGEGGGDSEGKQR 102

Query: 330 VERTLGDATQDIDSSAEKESEKEQDD----------DLKKEVSAEGNKEESTSPASMGEW 181
V+ +G A+ D S S + + ++K + EG + E + ++ W
Sbjct: 103 VDAVIGSASGDGGSQPAITSPRSRKPLKVAMEAMIRGIEKYMEVEGKEREEEARPNVTAW 162

Query: 180 ELISQGQER 154
+ +ER
Sbjct: 163 HNVPCPEER 171


>tr|Q1M319|Q1M319_SOLLC Putative beta-glycosidase OS=Solanum
lycopersicum GN=sfr2 PE=2 SV=1
Length = 642

Score = 73.2 bits (178), Expect = 7e-12
Identities = 38/93 (40%), Positives = 55/93 (59%)
Frame = -2

Query: 510 DEDQEILAQFPIDKDVDDGGFFFALATAPAHVEDKLDDAWLQFAKETPPKQKKESGFRQA 331
D+ ++LA F ++ + GFFF LATAPAHVED+LDDAWLQFAK T + ++ Q
Sbjct: 45 DDSADVLAHFNLNPSEGEKGFFFGLATAPAHVEDRLDDAWLQFAKNTESHEIQQP---QT 101

Query: 330 VERTLGDATQDIDSSAEKESEKEQDDDLKKEVS 232
+ +G AT D S ++E +K++ S
Sbjct: 102 ADAIMGSATGDGGSQQALLPQREATKTIKRKKS 134


>tr|Q1M317|Q1M317_PINTA Putative beta-glycosidase OS=Pinus taeda
GN=sfr2 PE=2 SV=1
Length = 666

Score = 73.2 bits (178), Expect = 7e-12
Identities = 36/67 (53%), Positives = 43/67 (64%), Gaps = 11/67 (16%)
Frame = -2

Query: 510 DEDQEILAQFPIDKDVDDGGFFFALATAPAHVEDKLDDAWLQFAK-----------ETPP 364
DE +E+LA F DK+ DDGGFFF LATAPAHVED L DAWL+FA+ + PP
Sbjct: 47 DESEEVLATFDTDKNEDDGGFFFGLATAPAHVEDNLHDAWLEFAENDTADSNPQPSDQPP 106

Query: 363 KQKKESG 343
K + G
Sbjct: 107 KITRSKG 113


>tr|Q9C8Z2|Q9C8Z2_ARATH Beta-glucosidase, putative; 69917-66834
OS=Arabidopsis thaliana GN=F5E6.16 PE=3 SV=1
Length = 618

Score = 70.5 bits (171), Expect = 5e-11
Identities = 43/103 (41%), Positives = 59/103 (57%), Gaps = 6/103 (5%)
Frame = -2

Query: 510 DEDQEILAQFPIDKDVDDGGFFFALATAPAHVEDKLDDAWLQFAKETPPKQKK-----ES 346
DE +E+LA F + ++G FFF LATAPAH ED LDDAWLQFAKETP ++ +
Sbjct: 42 DESKEVLADFN-SIEHEEGKFFFGLATAPAHAEDDLDDAWLQFAKETPCSAEEAEAADKK 100

Query: 345 GFRQAVERTLGDATQDIDSSAE-KESEKEQDDDLKKEVSAEGN 220
R+ V+ +G T+ + + KE + D K V+A N
Sbjct: 101 ARRKKVKLAVGAITKGLAKNTHGKEDKNAADKPPSKNVAAWHN 143


>tr|Q93Y07|Q93Y07_ARATH Beta-glucosidase, putative (Putative
beta-glycosidase) OS=Arabidopsis thaliana
GN=At3g06510/F5E6.16 PE=2 SV=1
Length = 622

Score = 70.5 bits (171), Expect = 5e-11
Identities = 43/103 (41%), Positives = 59/103 (57%), Gaps = 6/103 (5%)
Frame = -2

Query: 510 DEDQEILAQFPIDKDVDDGGFFFALATAPAHVEDKLDDAWLQFAKETPPKQKK-----ES 346
DE +E+LA F + ++G FFF LATAPAH ED LDDAWLQFAKETP ++ +
Sbjct: 42 DESKEVLADFN-SIEHEEGKFFFGLATAPAHAEDDLDDAWLQFAKETPCSAEEAEAADKK 100

Query: 345 GFRQAVERTLGDATQDIDSSAE-KESEKEQDDDLKKEVSAEGN 220
R+ V+ +G T+ + + KE + D K V+A N
Sbjct: 101 ARRKKVKLAVGAITKGLAKNTHGKEDKNAADKPPSKNVAAWHN 143


>tr|Q8LGU5|Q8LGU5_ARATH Mutant putative beta-glycosidase
OS=Arabidopsis thaliana GN=sfr2 PE=2 SV=1
Length = 622

Score = 70.5 bits (171), Expect = 5e-11
Identities = 43/103 (41%), Positives = 59/103 (57%), Gaps = 6/103 (5%)
Frame = -2

Query: 510 DEDQEILAQFPIDKDVDDGGFFFALATAPAHVEDKLDDAWLQFAKETPPKQKK-----ES 346
DE +E+LA F + ++G FFF LATAPAH ED LDDAWLQFAKETP ++ +
Sbjct: 42 DESKEVLADFN-SIEHEEGKFFFGLATAPAHAEDDLDDAWLQFAKETPCSAEEAEAADKK 100

Query: 345 GFRQAVERTLGDATQDIDSSAE-KESEKEQDDDLKKEVSAEGN 220
R+ V+ +G T+ + + KE + D K V+A N
Sbjct: 101 ARRKKVKLAVGAITKGLAKNTHGKEDKNAADKPPSKNVAAWHN 143


>tr|Q8LGU4|Q8LGU4_ARATH Mutant putative beta-glycosidase
OS=Arabidopsis thaliana GN=sfr2 PE=2 SV=1
Length = 183

Score = 70.5 bits (171), Expect = 5e-11
Identities = 43/103 (41%), Positives = 59/103 (57%), Gaps = 6/103 (5%)
Frame = -2

Query: 510 DEDQEILAQFPIDKDVDDGGFFFALATAPAHVEDKLDDAWLQFAKETPPKQKK-----ES 346
DE +E+LA F + ++G FFF LATAPAH ED LDDAWLQFAKETP ++ +
Sbjct: 42 DESKEVLADFN-SIEHEEGKFFFGLATAPAHAEDDLDDAWLQFAKETPCSAEEAEAADKK 100

Query: 345 GFRQAVERTLGDATQDIDSSAE-KESEKEQDDDLKKEVSAEGN 220
R+ V+ +G T+ + + KE + D K V+A N
Sbjct: 101 ARRKKVKLAVGAITKGLAKNTHGKEDKNAADKPPSKNVAAWHN 143


>tr|Q8LAN2|Q8LAN2_ARATH Beta-glucosidase, putative OS=Arabidopsis
thaliana PE=2 SV=1
Length = 622

Score = 70.5 bits (171), Expect = 5e-11
Identities = 43/103 (41%), Positives = 59/103 (57%), Gaps = 6/103 (5%)
Frame = -2

Query: 510 DEDQEILAQFPIDKDVDDGGFFFALATAPAHVEDKLDDAWLQFAKETPPKQKK-----ES 346
DE +E+LA F + ++G FFF LATAPAH ED LDDAWLQFAKETP ++ +
Sbjct: 42 DESKEVLADFN-SIEHEEGKFFFGLATAPAHAEDDLDDAWLQFAKETPCSAEEAEAADKK 100

Query: 345 GFRQAVERTLGDATQDIDSSAE-KESEKEQDDDLKKEVSAEGN 220
R+ V+ +G T+ + + KE + D K V+A N
Sbjct: 101 ARRKKVKLAVGAITKGLAKNTHGKEDKNAADKPPSKNVAAWHN 143