BP921554
Clone id YMU001_000151_D05
Library
Length 517
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000151_D05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GAGCTGGAGGCAGCTCGAGAGGAGGGAAGGCAGGAAGCTGCAAAGGAGAGTGAAGCAGAG
CTGAATGATCTGCTTGTATGTCTTGGGCAGGAGGAAAGCAAGGTCGAGAGGCTGAGGACA
CGCTTGGAAGAATTGGGTGAGGATGTTCAGGCATTGCTTCAGGGAATTGGTGAGGAACCT
GAAGGAGAACAGGTTGGAGAAGAGTCGTAAAGGCAAAAACATGTCAGAATTTGCACACTG
TTTGTCTGTGGTTTCTTATCTGGGGTTTACAAGTCCTCCTCACTGGTTGAACTCTCAGCC
CTATCATCGCGTGGGACTTGGTGGATCTATACCCTTGTATGGAATGTATAGAGCCTCTAC
AACTCCAGTGACCAAGTTCTTACCAGTCCTGATGGCATTTATTAGCTATTAGTATGACCC
TCCAGCTGTATATTAAGTTGCTTGTCATTTTGATGTTTGAGAGAGCTAACATATTTCTCA
TTTGATTAGTCTCTGATAACAAGCTTTTCTCTGCCTT
■■Homology search results ■■ -
sp_hit_id B0F9L4
Definition sp|B0F9L4|GOGC6_ARATH Golgin candidate 6 OS=Arabidopsis thaliana
Align length 38
Score (bit) 43.1
E-value 0.0008
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921554|Adiantum capillus-veneris mRNA, clone:
YMU001_000151_D05.
(517 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|B0F9L4|GOGC6_ARATH Golgin candidate 6 OS=Arabidopsis thaliana... 43 8e-04
sp|P97680|RIN1_RAT Ras and Rab interactor 1 OS=Rattus norvegicus... 31 3.0
sp|Q921Q7|RIN1_MOUSE Ras and Rab interactor 1 OS=Mus musculus GN... 31 3.0
sp|Q6P444|FA54A_HUMAN Protein FAM54A OS=Homo sapiens GN=FAM54A P... 30 5.2

>sp|B0F9L4|GOGC6_ARATH Golgin candidate 6 OS=Arabidopsis thaliana
GN=GC6 PE=2 SV=2
Length = 914

Score = 43.1 bits (100), Expect = 8e-04
Identities = 23/38 (60%), Positives = 24/38 (63%)
Frame = +1

Query: 49 SEAELNDLLVCLGQEESKVXXXXXXXXXXGEDVQALLQ 162
SE ELNDLLVCLGQEESKV G DV LL+
Sbjct: 862 SEDELNDLLVCLGQEESKVEKLSAKLIELGVDVDKLLE 899


>sp|P97680|RIN1_RAT Ras and Rab interactor 1 OS=Rattus norvegicus
GN=Rin1 PE=2 SV=2
Length = 774

Score = 31.2 bits (69), Expect = 3.0
Identities = 14/34 (41%), Positives = 19/34 (55%)
Frame = -1

Query: 163 PEAMPEHPHPILPSVSSASRPCFPPAQDIQADHS 62
P A+P P P+LP SS+ PP Q +Q + S
Sbjct: 258 PPAVPPPPVPVLPGTSSSQTERLPPRQLLQRESS 291


>sp|Q921Q7|RIN1_MOUSE Ras and Rab interactor 1 OS=Mus musculus
GN=Rin1 PE=1 SV=1
Length = 763

Score = 31.2 bits (69), Expect = 3.0
Identities = 14/34 (41%), Positives = 19/34 (55%)
Frame = -1

Query: 163 PEAMPEHPHPILPSVSSASRPCFPPAQDIQADHS 62
P A+P P P+LP SS+ PP Q +Q + S
Sbjct: 247 PPAVPPPPVPVLPGTSSSQTERLPPRQLLQRESS 280


>sp|Q6P444|FA54A_HUMAN Protein FAM54A OS=Homo sapiens GN=FAM54A PE=2
SV=2
Length = 385

Score = 30.4 bits (67), Expect = 5.2
Identities = 12/23 (52%), Positives = 13/23 (56%)
Frame = -1

Query: 151 PEHPHPILPSVSSASRPCFPPAQ 83
P P P+ P SS PCFPP Q
Sbjct: 208 PPPPPPLPPQFSSLQPPCFPPVQ 230


tr_hit_id Q2QP84
Definition tr|Q2QP84|Q2QP84_ORYSJ Os12g0538900 protein OS=Oryza sativa subsp. japonica
Align length 38
Score (bit) 48.5
E-value 0.0002
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP921554|Adiantum capillus-veneris mRNA, clone:
YMU001_000151_D05.
(517 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q2QP84|Q2QP84_ORYSJ Os12g0538900 protein OS=Oryza sativa subs... 49 2e-04
tr|B8BMB4|B8BMB4_ORYSI Putative uncharacterized protein OS=Oryza... 49 2e-04
tr|A3CI41|A3CI41_ORYSJ Putative uncharacterized protein OS=Oryza... 49 2e-04
tr|A5CAJ6|A5CAJ6_VITVI Putative uncharacterized protein OS=Vitis... 47 6e-04
tr|O65753|O65753_CICAR Putative uncharacterized protein (Fragmen... 45 0.002
tr|A8YJF0|A8YJF0_MICAE Similar to tr|A3IUE8|A3IUE8_9CHRO Sigma f... 41 0.041
tr|A9TYU0|A9TYU0_PHYPA Predicted protein OS=Physcomitrella paten... 41 0.041
tr|B5W062|B5W062_SPIMA RNA polymerase, sigma 28 subunit, FliA/Wh... 37 0.59
tr|B0JY76|B0JY76_MICAN RNA polymerase sigma factor OS=Microcysti... 36 1.0
tr|A0YKT8|A0YKT8_9CYAN Sigma factor SigF OS=Lyngbya sp. PCC 8106... 36 1.3
tr|A4RXK2|A4RXK2_OSTLU Predicted protein OS=Ostreococcus lucimar... 36 1.3
tr|B2IZ53|B2IZ53_NOSP7 RNA polymerase, sigma 28 subunit, FliA/Wh... 35 1.7
tr|Q8YQH5|Q8YQH5_ANASP RNA polymerase sigma factor OS=Anabaena s... 35 2.9
tr|Q3MC20|Q3MC20_ANAVT RNA polymerase sigma factor OS=Anabaena v... 35 2.9
tr|Q019A0|Q019A0_OSTTA Vesicle tethering family protein (ISS) OS... 34 5.0
tr|B4AZQ9|B4AZQ9_9CHRO RNA polymerase, sigma 28 subunit, FliA/Wh... 33 6.5
tr|Q4QSA9|Q4QSA9_RHOMR Putative NhaD type antiporter OS=Rhodothe... 33 8.5
tr|A9SWL2|A9SWL2_PHYPA Predicted protein OS=Physcomitrella paten... 33 8.5

>tr|Q2QP84|Q2QP84_ORYSJ Os12g0538900 protein OS=Oryza sativa subsp.
japonica GN=Os12g0538900 PE=2 SV=1
Length = 929

Score = 48.5 bits (114), Expect = 2e-04
Identities = 25/38 (65%), Positives = 26/38 (68%)
Frame = +1

Query: 49 SEAELNDLLVCLGQEESKVXXXXXXXXXXGEDVQALLQ 162
SEAELNDLLVCLGQE+SKV GEDV LLQ
Sbjct: 872 SEAELNDLLVCLGQEQSKVEKLSTRLAELGEDVDTLLQ 909


>tr|B8BMB4|B8BMB4_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_38607 PE=4 SV=1
Length = 1051

Score = 48.5 bits (114), Expect = 2e-04
Identities = 25/38 (65%), Positives = 26/38 (68%)
Frame = +1

Query: 49 SEAELNDLLVCLGQEESKVXXXXXXXXXXGEDVQALLQ 162
SEAELNDLLVCLGQE+SKV GEDV LLQ
Sbjct: 994 SEAELNDLLVCLGQEQSKVEKLSTRLAELGEDVDTLLQ 1031


>tr|A3CI41|A3CI41_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_034963 PE=4 SV=1
Length = 829

Score = 48.5 bits (114), Expect = 2e-04
Identities = 25/38 (65%), Positives = 26/38 (68%)
Frame = +1

Query: 49 SEAELNDLLVCLGQEESKVXXXXXXXXXXGEDVQALLQ 162
SEAELNDLLVCLGQE+SKV GEDV LLQ
Sbjct: 772 SEAELNDLLVCLGQEQSKVEKLSTRLAELGEDVDTLLQ 809


>tr|A5CAJ6|A5CAJ6_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_003069 PE=4 SV=1
Length = 131

Score = 47.0 bits (110), Expect = 6e-04
Identities = 24/38 (63%), Positives = 26/38 (68%)
Frame = +1

Query: 49 SEAELNDLLVCLGQEESKVXXXXXXXXXXGEDVQALLQ 162
SEAELNDLLVCLGQE+SKV GEDV LL+
Sbjct: 77 SEAELNDLLVCLGQEQSKVEKLSARLLELGEDVDKLLE 114


>tr|O65753|O65753_CICAR Putative uncharacterized protein (Fragment)
OS=Cicer arietinum PE=2 SV=1
Length = 129

Score = 45.4 bits (106), Expect = 0.002
Identities = 23/38 (60%), Positives = 25/38 (65%)
Frame = +1

Query: 49 SEAELNDLLVCLGQEESKVXXXXXXXXXXGEDVQALLQ 162
SE ELNDLLVCLGQE+SKV GEDV LL+
Sbjct: 73 SEGELNDLLVCLGQEQSKVDRLSARLLELGEDVDQLLE 110


>tr|A8YJF0|A8YJF0_MICAE Similar to tr|A3IUE8|A3IUE8_9CHRO Sigma
factor SigF OS=Microcystis aeruginosa PCC 7806
GN=IPF_5732 PE=4 SV=1
Length = 258

Score = 40.8 bits (94), Expect = 0.041
Identities = 21/84 (25%), Positives = 41/84 (48%)
Frame = -1

Query: 487 NQMRNMLALSNIKMTSNLIYSWRVILIANKCHQDW*ELGHWSCRGSIHSIQGYRSTKSHA 308
NQ+R+ + N+ + + W N+CH+++ +L C G I +I+ + S+K HA
Sbjct: 26 NQLRDQIIRLNLGLVRREAHHW-----VNQCHENYEDLVQVGCMGLIRAIKRFDSSKGHA 80

Query: 307 MIGLRVQPVRRTCKPQIRNHRQTV 236
+ +R + +R+ TV
Sbjct: 81 FSSFAIPYIRGEIQHYLRDKGYTV 104


>tr|A9TYU0|A9TYU0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_199606 PE=4 SV=1
Length = 917

Score = 40.8 bits (94), Expect = 0.041
Identities = 21/36 (58%), Positives = 23/36 (63%)
Frame = +1

Query: 52 EAELNDLLVCLGQEESKVXXXXXXXXXXGEDVQALL 159
E ELN+LLVCLGQEE+KV GEDV LL
Sbjct: 860 EDELNELLVCLGQEETKVERLSARLRELGEDVDKLL 895


>tr|B5W062|B5W062_SPIMA RNA polymerase, sigma 28 subunit, FliA/WhiG
family OS=Arthrospira maxima CS-328 GN=AmaxDRAFT_2154
PE=4 SV=1
Length = 255

Score = 37.0 bits (84), Expect = 0.59
Identities = 21/87 (24%), Positives = 40/87 (45%)
Frame = -1

Query: 496 SETNQMRNMLALSNIKMTSNLIYSWRVILIANKCHQDW*ELGHWSCRGSIHSIQGYRSTK 317
S +N +RN L NI + ++ W N+C + + +L C G I +I+ + +K
Sbjct: 23 SPSNSVRNQLVQINIGLVRKEVHHW-----LNQCTESYDDLLQVGCIGLIRAIERFDMSK 77

Query: 316 SHAMIGLRVQPVRRTCKPQIRNHRQTV 236
HA + +R + +R+ +V
Sbjct: 78 GHAFSSFAIPYIRGEIQHYLRDKSPSV 104


>tr|B0JY76|B0JY76_MICAN RNA polymerase sigma factor OS=Microcystis
aeruginosa (strain NIES-843) GN=sigF PE=3 SV=1
Length = 258

Score = 36.2 bits (82), Expect = 1.0
Identities = 19/84 (22%), Positives = 40/84 (47%)
Frame = -1

Query: 487 NQMRNMLALSNIKMTSNLIYSWRVILIANKCHQDW*ELGHWSCRGSIHSIQGYRSTKSHA 308
N++R+ + N+ + + W N+CH+++ +L G I +I+ + S+K HA
Sbjct: 26 NKLRDQIMELNLGLVRREAHHW-----VNQCHENYEDLVQVGSMGLIRAIERFDSSKGHA 80

Query: 307 MIGLRVQPVRRTCKPQIRNHRQTV 236
+ +R + +R+ TV
Sbjct: 81 FSSFAIPYIRGEIQHHLRDKSYTV 104


>tr|A0YKT8|A0YKT8_9CYAN Sigma factor SigF OS=Lyngbya sp. PCC 8106
GN=L8106_09326 PE=4 SV=1
Length = 259

Score = 35.8 bits (81), Expect = 1.3
Identities = 19/82 (23%), Positives = 39/82 (47%)
Frame = -1

Query: 496 SETNQMRNMLALSNIKMTSNLIYSWRVILIANKCHQDW*ELGHWSCRGSIHSIQGYRSTK 317
S + ++RN L NI + ++ W N+C +++ +L C G I +I+ + +K
Sbjct: 23 SNSKELRNQLVQLNIGLVRKEVHHW-----VNQCTENYDDLLQVGCIGLIRAIERFDLSK 77

Query: 316 SHAMIGLRVQPVRRTCKPQIRN 251
HA + +R + +R+
Sbjct: 78 GHAFSSFAIPYIRGEIQHYLRD 99