DK943537
Clone id YMU02A01NGRL0003_C08
Library
Length 263
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0003_C08. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
CTTTTTTAAATGAAATTGGGCTTATGTGTTTCGTAGGAAATCCTGGTCATGACTAGTGCT
TGGATTCTACCCAATAATAAAAACCCGGCGGCAACGGATCGTTCTGAACTTATCGGAATG
GAGTTCTGAGGTCCTTACTGGATCTATCTCCAGGTGTCCCACCGAGTGCGATTTCAAATT
ACACCCCGGCCTGTCACTAATCGTTCTACTGATGTGATTCCTTACACATTCTGCCGACTT
GAAATCAATCACAAACGGCATGA
■■Homology search results ■■ -
sp_hit_id P03042
Definition sp|P03042|RPC2_LAMBD Regulatory protein CII OS=Enterobacteria phage lambda
Align length 23
Score (bit) 32.0
E-value 1.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943537|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0003_C08, 5'
(263 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P03042|RPC2_LAMBD Regulatory protein CII OS=Enterobacteria ph... 32 1.0
sp|P03043|RPC2_BP434 Regulatory protein CII OS=Bacteriophage 434... 32 1.0
sp|Q5XGW0|VATG3_XENLA V-type proton ATPase subunit G 3 OS=Xenopu... 29 8.5

>sp|P03042|RPC2_LAMBD Regulatory protein CII OS=Enterobacteria phage
lambda GN=CII PE=1 SV=1
Length = 97

Score = 32.0 bits (71), Expect = 1.0
Identities = 16/23 (69%), Positives = 17/23 (73%)
Frame = +1

Query: 58 AWILPNNKNPAATDRSELIGMEF 126
A IL N K PAAT+RSE I MEF
Sbjct: 75 AAILTNKKRPAATERSEQIQMEF 97


>sp|P03043|RPC2_BP434 Regulatory protein CII OS=Bacteriophage 434
GN=CII PE=3 SV=1
Length = 97

Score = 32.0 bits (71), Expect = 1.0
Identities = 16/23 (69%), Positives = 17/23 (73%)
Frame = +1

Query: 58 AWILPNNKNPAATDRSELIGMEF 126
A IL N K PAAT+RSE I MEF
Sbjct: 75 ASILTNKKRPAATERSEQIQMEF 97


>sp|Q5XGW0|VATG3_XENLA V-type proton ATPase subunit G 3 OS=Xenopus
laevis GN=atp6v1g3 PE=3 SV=1
Length = 118

Score = 28.9 bits (63), Expect = 8.5
Identities = 12/30 (40%), Positives = 19/30 (63%)
Frame = +3

Query: 93 NGSF*TYRNGVLRSLLDLSPGVPPSAISNY 182
+ S+ Y+ GVL+ LLDL+ + P +NY
Sbjct: 85 SSSYNKYKEGVLKELLDLAYNIKPELHTNY 114


tr_hit_id A8P518
Definition tr|A8P518|A8P518_BRUMA Putative uncharacterized protein OS=Brugia malayi
Align length 63
Score (bit) 33.5
E-value 5.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943537|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0003_C08, 5'
(263 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A8P518|A8P518_BRUMA Putative uncharacterized protein OS=Brugi... 33 5.4

>tr|A8P518|A8P518_BRUMA Putative uncharacterized protein OS=Brugia
malayi GN=Bm1_16585 PE=4 SV=1
Length = 1529

Score = 33.5 bits (75), Expect = 5.4
Identities = 18/63 (28%), Positives = 31/63 (49%)
Frame = -3

Query: 240 KSAECVRNHISRTISDRPGCNLKSHSVGHLEIDPVRTSELHSDKFRTIRCRRVFIIG*NP 61
+ ++C RN +S + S PGCNLK ++ + V HS R+ ++ +P
Sbjct: 258 QDSKCPRNSLSASSSGLPGCNLKWNATENSPPQKVSRGRTHSSVSRSESSNSEAMLSPDP 317

Query: 60 STS 52
ST+
Sbjct: 318 STT 320