DK943589
Clone id YMU02A01NGRL0003_E24
Library
Length 390
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0003_E24. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
ATATACTTGCTGAAACTGTCAAAAGGAGGAGAAAGACTACCAGCATGCCCTACTCTCGCT
CGATTGTTGGTGCTTCGCTTGATGTGATTCACATGATACTCGTCTAAAAGACTGATCTTA
CAGCTGCTGCTCGTGAAGCTGCGCTAAGGGAGATCATTGAGCCAATCATGAAAACCTAGG
ATGAAAAGAAGGCTAAGAAGGCTGATCTAGTGTCTTACTCCTCCTGAGCTGCCGCCCTAG
ATGCTATGTATAAAGGTGCAATGCTTTTAGGTCCTAAGCTTGATGGTGATGATGTGAATC
CATCAAGGTGTACGCCGTATTCCTTTGACTCTGAAGACGGGGTCTCTTTTACTTCTATGA
TTTGTAAGCCGAGTTCTCAATTTTGTCTTA
■■Homology search results ■■ -
sp_hit_id O65743
Definition sp|O65743|RL24_CICAR 60S ribosomal protein L24 OS=Cicer arietinum
Align length 92
Score (bit) 51.2
E-value 2.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943589|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0003_E24, 5'
(390 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O65743|RL24_CICAR 60S ribosomal protein L24 OS=Cicer arietinu... 51 2e-06
sp|P50888|RL24_HORVU 60S ribosomal protein L24 OS=Hordeum vulgar... 49 8e-06
sp|Q9FUL4|RL24_PRUAV 60S ribosomal protein L24 OS=Prunus avium G... 47 2e-05
sp|P38666|RL242_ARATH 60S ribosomal protein L24-2 OS=Arabidopsis... 42 7e-04
sp|Q42347|RL241_ARATH 60S ribosomal protein L24-1 OS=Arabidopsis... 42 0.001
sp|Q9QWY8|ASAP1_MOUSE Arf-GAP with SH3 domain, ANK repeat and PH... 30 4.9
sp|Q8VIM6|STRC_MOUSE Stereocilin OS=Mus musculus GN=Strc PE=2 SV=1 29 8.4
sp|Q9SSC9|AHP6_ARATH Histidine-containing phosphotransfer protei... 29 8.4

>sp|O65743|RL24_CICAR 60S ribosomal protein L24 OS=Cicer arietinum
GN=RPL24 PE=2 SV=1
Length = 164

Score = 51.2 bits (121), Expect = 2e-06
Identities = 32/92 (34%), Positives = 45/92 (48%)
Frame = +3

Query: 12 ETVKRRRKTTSMPYSRSIVGASLDVIHMILV*KTDLTXXXXXXXXXXXXXPIMKT*DEXX 191
E VK+RR+ T PYSRSIVGA+L+VI K ++ I KT DE
Sbjct: 68 EAVKKRRRATKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALREIKERIKKTKDEKK 127

Query: 192 XXXXDLVSYSS*AAALDAMYKGAMLLGPKLDG 287
++ S + + + KGA+ GPK+ G
Sbjct: 128 AKKAEVASKAQKSQGKGNVQKGALPKGPKMGG 159


>sp|P50888|RL24_HORVU 60S ribosomal protein L24 OS=Hordeum vulgare
GN=RPL24 PE=2 SV=1
Length = 162

Score = 48.9 bits (115), Expect = 8e-06
Identities = 34/95 (35%), Positives = 44/95 (46%)
Frame = +3

Query: 3 ILAETVKRRRKTTSMPYSRSIVGASLDVIHMILV*KTDLTXXXXXXXXXXXXXPIMKT*D 182
I AE K+RR+TT PYSRSIVGA+L+VI K ++ I KT D
Sbjct: 65 IHAEAAKKRRRTTKKPYSRSIVGATLEVIQKKRAEKPEVRDAAREAALREIKERIKKTKD 124

Query: 183 EXXXXXXDLVSYSS*AAALDAMYKGAMLLGPKLDG 287
E ++ A+ KG+ GPKL G
Sbjct: 125 EKKAKKAEVTKSQKSQGGKGAVQKGSK--GPKLGG 157


>sp|Q9FUL4|RL24_PRUAV 60S ribosomal protein L24 OS=Prunus avium
GN=RPL24 PE=2 SV=1
Length = 186

Score = 47.4 bits (111), Expect = 2e-05
Identities = 33/95 (34%), Positives = 41/95 (43%)
Frame = +3

Query: 3 ILAETVKRRRKTTSMPYSRSIVGASLDVIHMILV*KTDLTXXXXXXXXXXXXXPIMKT*D 182
I E VK+RR+TT PYSRSIVGA+L+VI K ++ I KT D
Sbjct: 65 IAQEAVKKRRRTTKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAALREIKERIKKTKD 124

Query: 183 EXXXXXXDLVSYSS*AAALDAMYKGAMLLGPKLDG 287
E ++ GA GPKL G
Sbjct: 125 EKKAKKAEVTKSQKSQGKGSIAKGGAQPKGPKLGG 159


>sp|P38666|RL242_ARATH 60S ribosomal protein L24-2 OS=Arabidopsis
thaliana GN=RPL24B PE=2 SV=2
Length = 163

Score = 42.4 bits (98), Expect = 7e-04
Identities = 32/92 (34%), Positives = 40/92 (43%)
Frame = +3

Query: 12 ETVKRRRKTTSMPYSRSIVGASLDVIHMILV*KTDLTXXXXXXXXXXXXXPIMKT*DEXX 191
E VKRRR+ T PYSRSIVGA+L+VI K ++ I KT DE
Sbjct: 68 EAVKRRRRATKKPYSRSIVGATLEVIQKKRAEKPEVRDAAREAALREIKERIKKTKDEKK 127

Query: 192 XXXXDLVSYSS*AAALDAMYKGAMLLGPKLDG 287
+ S A + A GPK+ G
Sbjct: 128 AKKVEFASKQQKVKA-NFPKAAAASKGPKVGG 158


>sp|Q42347|RL241_ARATH 60S ribosomal protein L24-1 OS=Arabidopsis
thaliana GN=RPL24A PE=1 SV=2
Length = 164

Score = 41.6 bits (96), Expect = 0.001
Identities = 25/58 (43%), Positives = 30/58 (51%)
Frame = +3

Query: 12 ETVKRRRKTTSMPYSRSIVGASLDVIHMILV*KTDLTXXXXXXXXXXXXXPIMKT*DE 185
E VKRRR+ T PYSRSIVGA+L+VI K ++ I KT DE
Sbjct: 68 EAVKRRRRATKKPYSRSIVGATLEVIQKKRAEKPEVRDAAREAALREIKERIKKTKDE 125


>sp|Q9QWY8|ASAP1_MOUSE Arf-GAP with SH3 domain, ANK repeat and PH
domain-containing protein 1 OS=Mus musculus GN=Asap1
PE=1 SV=1
Length = 1147

Score = 29.6 bits (65), Expect = 4.9
Identities = 17/48 (35%), Positives = 24/48 (50%)
Frame = -3

Query: 376 ELGLQIIEVKETPSSESKEYGVHLDGFTSSPSSLGPKSIAPLYIASRA 233
+L + +K+T E K+ D SS L PK + LY+ASRA
Sbjct: 267 KLAADLYNIKQTQDEEKKQLTALRDLIKSS-LQLDPKEVGGLYVASRA 313


>sp|Q8VIM6|STRC_MOUSE Stereocilin OS=Mus musculus GN=Strc PE=2 SV=1
Length = 1809

Score = 28.9 bits (63), Expect = 8.4
Identities = 14/32 (43%), Positives = 15/32 (46%)
Frame = +3

Query: 270 GPKLDGDDVNPSRCTPYSFDSEDGVSFTSMIC 365
GP LD D P R P DG SF M+C
Sbjct: 547 GPTLDATDFPPCRVGPCGERCPDGGSFLLMVC 578


>sp|Q9SSC9|AHP6_ARATH Histidine-containing phosphotransfer protein 6
OS=Arabidopsis thaliana GN=AHP6 PE=2 SV=2
Length = 154

Score = 28.9 bits (63), Expect = 8.4
Identities = 12/37 (32%), Positives = 24/37 (64%)
Frame = -3

Query: 334 SESKEYGVHLDGFTSSPSSLGPKSIAPLYIASRAAAQ 224
S+ K+ G+HL+ S SS+G + + + +A R+A++
Sbjct: 73 SDYKKIGLHLNQLVGSSSSIGARRVRNVCVAFRSASE 109


tr_hit_id B8LQH6
Definition tr|B8LQH6|B8LQH6_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 95
Score (bit) 56.2
E-value 8.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943589|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0003_E24, 5'
(390 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8LQH6|B8LQH6_PICSI Putative uncharacterized protein OS=Picea... 56 8e-07
tr|A9PHF8|A9PHF8_POPTR Putative uncharacterized protein OS=Popul... 56 1e-06
tr|B6TLK1|B6TLK1_MAIZE 60S ribosomal protein L24 OS=Zea mays PE=... 51 3e-05
tr|B4FKH2|B4FKH2_MAIZE Putative uncharacterized protein OS=Zea m... 51 3e-05
tr|A9P8N0|A9P8N0_POPTR Putative uncharacterized protein OS=Popul... 50 4e-05
tr|B7FN60|B7FN60_MEDTR Putative uncharacterized protein OS=Medic... 50 6e-05
tr|B3TM46|B3TM46_ELAGV 60S ribosomal protein L24 OS=Elaeis guine... 50 6e-05
tr|B4FFR7|B4FFR7_MAIZE Putative uncharacterized protein OS=Zea m... 50 7e-05
tr|B6T1G6|B6T1G6_MAIZE 60S ribosomal protein L24 OS=Zea mays PE=... 49 1e-04
tr|B6TTC4|B6TTC4_MAIZE 60S ribosomal protein L24 OS=Zea mays PE=... 48 3e-04
tr|A7QVI1|A7QVI1_VITVI Chromosome chr16 scaffold_189, whole geno... 48 3e-04
tr|Q75KZ3|Q75KZ3_ORYSJ Os05g0486700 protein OS=Oryza sativa subs... 47 4e-04
tr|Q5N754|Q5N754_ORYSJ cDNA clone:001-018-A11, full insert seque... 47 4e-04
tr|B8ABA2|B8ABA2_ORYSI Putative uncharacterized protein OS=Oryza... 47 4e-04
tr|A2ZYY6|A2ZYY6_ORYSJ Putative uncharacterized protein OS=Oryza... 47 4e-04
tr|A2Y5X8|A2Y5X8_ORYSI Putative uncharacterized protein OS=Oryza... 47 4e-04
tr|B3TLK8|B3TLK8_ELAGV 60S ribosomal protein L24 OS=Elaeis guine... 47 5e-04
tr|A9SBP8|A9SBP8_PHYPA Predicted protein OS=Physcomitrella paten... 47 6e-04
tr|A9P8J6|A9P8J6_POPTR Putative uncharacterized protein OS=Popul... 47 6e-04
tr|Q8L3Y6|Q8L3Y6_ORYSJ Putative 60S ribosomal protein L24 OS=Ory... 46 8e-04
tr|Q0D7Q0|Q0D7Q0_ORYSJ Os07g0224000 protein OS=Oryza sativa subs... 46 8e-04
tr|B8B8G9|B8B8G9_ORYSI Putative uncharacterized protein OS=Oryza... 46 8e-04
tr|A9RF19|A9RF19_PHYPA Predicted protein OS=Physcomitrella paten... 45 0.001
tr|A9SZ60|A9SZ60_PHYPA Predicted protein OS=Physcomitrella paten... 45 0.002
tr|A7PPN3|A7PPN3_VITVI Chromosome chr8 scaffold_23, whole genome... 44 0.003
tr|Q1SN35|Q1SN35_MEDTR Ribosomal protein L24E OS=Medicago trunca... 44 0.004
tr|A9SAK6|A9SAK6_PHYPA Predicted protein OS=Physcomitrella paten... 44 0.004
tr|A9SFW0|A9SFW0_PHYPA Predicted protein OS=Physcomitrella paten... 44 0.005
tr|B6T6E3|B6T6E3_MAIZE 60S ribosomal protein L24 OS=Zea mays PE=... 43 0.007
tr|A7QZS6|A7QZS6_VITVI Chromosome chr13 scaffold_286, whole geno... 43 0.007

>tr|B8LQH6|B8LQH6_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 164

Score = 56.2 bits (134), Expect = 8e-07
Identities = 38/95 (40%), Positives = 48/95 (50%)
Frame = +3

Query: 3 ILAETVKRRRKTTSMPYSRSIVGASLDVIHMILV*KTDLTXXXXXXXXXXXXXPIMKT*D 182
I AE VK+RR+TT+ PYSRSIVGASL+VI KT++ I KT D
Sbjct: 65 IHAEQVKKRRRTTNKPYSRSIVGASLEVIQKKRTEKTEVRAAAREAALKEIKERIKKTKD 124

Query: 183 EXXXXXXDLVSYSS*AAALDAMYKGAMLLGPKLDG 287
E + V+ A + KG + GPKL G
Sbjct: 125 EKKAKKAETVAKGPKAQTKGNIPKGNISKGPKLGG 159


>tr|A9PHF8|A9PHF8_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 163

Score = 55.8 bits (133), Expect = 1e-06
Identities = 37/95 (38%), Positives = 51/95 (53%)
Frame = +3

Query: 3 ILAETVKRRRKTTSMPYSRSIVGASLDVIHMILV*KTDLTXXXXXXXXXXXXXPIMKT*D 182
I AETVK+RR+TT PYSRSIVGA+L+VI K ++ I KT D
Sbjct: 65 IAAETVKKRRRTTKKPYSRSIVGATLEVIQKKRAEKPEVRDAAREAALREIKERIKKTKD 124

Query: 183 EXXXXXXDLVSYSS*AAALDAMYKGAMLLGPKLDG 287
E +++S + ++ ++ KGA GPKL G
Sbjct: 125 EKKAKKAEVMSKAQ-KSSKGSLPKGAAPKGPKLGG 158


>tr|B6TLK1|B6TLK1_MAIZE 60S ribosomal protein L24 OS=Zea mays PE=2
SV=1
Length = 161

Score = 50.8 bits (120), Expect = 3e-05
Identities = 39/95 (41%), Positives = 47/95 (49%)
Frame = +3

Query: 3 ILAETVKRRRKTTSMPYSRSIVGASLDVIHMILV*KTDLTXXXXXXXXXXXXXPIMKT*D 182
I AE VK+RR+ T PYSRSIVGASL+VI K ++ I KT D
Sbjct: 65 IHAEAVKKRRRATKKPYSRSIVGASLEVIQKKRAEKPEVRDAAREAALREIKERIKKTKD 124

Query: 183 EXXXXXXDLVSYSS*AAALDAMYKGAMLLGPKLDG 287
E + VS S A A+ KG+ GPKL G
Sbjct: 125 EKKAKKAE-VSKSQKAQTKGAVQKGSK--GPKLGG 156


>tr|B4FKH2|B4FKH2_MAIZE Putative uncharacterized protein OS=Zea mays
PE=4 SV=1
Length = 106

Score = 50.8 bits (120), Expect = 3e-05
Identities = 39/95 (41%), Positives = 47/95 (49%)
Frame = +3

Query: 3 ILAETVKRRRKTTSMPYSRSIVGASLDVIHMILV*KTDLTXXXXXXXXXXXXXPIMKT*D 182
I AE VK+RR+ T PYSRSIVGASL+VI K ++ I KT D
Sbjct: 10 IHAEAVKKRRRATKKPYSRSIVGASLEVIQKKRAEKPEVRDAAREAALREIKERIKKTKD 69

Query: 183 EXXXXXXDLVSYSS*AAALDAMYKGAMLLGPKLDG 287
E + VS S A A+ KG+ GPKL G
Sbjct: 70 EKKAKKAE-VSKSQKAQTKGAVQKGSK--GPKLGG 101


>tr|A9P8N0|A9P8N0_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 163

Score = 50.4 bits (119), Expect = 4e-05
Identities = 34/95 (35%), Positives = 48/95 (50%)
Frame = +3

Query: 3 ILAETVKRRRKTTSMPYSRSIVGASLDVIHMILV*KTDLTXXXXXXXXXXXXXPIMKT*D 182
I AET+K+RR+ T PYSRSIVGA+L+VI K ++ I KT D
Sbjct: 65 IAAETIKKRRRATKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALREIKERIKKTKD 124

Query: 183 EXXXXXXDLVSYSS*AAALDAMYKGAMLLGPKLDG 287
E ++ + ++ ++ KGA GPKL G
Sbjct: 125 EKRAKKAEVTAKVQ-KSSKGSVPKGAAPKGPKLGG 158


>tr|B7FN60|B7FN60_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 163

Score = 50.1 bits (118), Expect = 6e-05
Identities = 34/95 (35%), Positives = 46/95 (48%)
Frame = +3

Query: 3 ILAETVKRRRKTTSMPYSRSIVGASLDVIHMILV*KTDLTXXXXXXXXXXXXXPIMKT*D 182
I E VK+RR+ T PYSRSIVGA+L+VI K ++ I KT D
Sbjct: 65 IAQEAVKKRRRATKKPYSRSIVGATLEVIQKKRTEKPEVRDAAREAALREIKERIKKTKD 124

Query: 183 EXXXXXXDLVSYSS*AAALDAMYKGAMLLGPKLDG 287
E ++ S + + + KGAM GPK+ G
Sbjct: 125 EKKAKKAEVASKAQ-KSGKGNVQKGAMPKGPKMGG 158


>tr|B3TM46|B3TM46_ELAGV 60S ribosomal protein L24 OS=Elaeis
guineensis var. tenera PE=2 SV=1
Length = 163

Score = 50.1 bits (118), Expect = 6e-05
Identities = 35/95 (36%), Positives = 46/95 (48%)
Frame = +3

Query: 3 ILAETVKRRRKTTSMPYSRSIVGASLDVIHMILV*KTDLTXXXXXXXXXXXXXPIMKT*D 182
I AE VK+RR+TT PYSRSIVGA+L+VI K ++ I KT D
Sbjct: 65 IHAEAVKKRRRTTKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAALREIKERIKKTKD 124

Query: 183 EXXXXXXDLVSYSS*AAALDAMYKGAMLLGPKLDG 287
E + ++ + +M KG GPKL G
Sbjct: 125 EKKAKKAETLAKTQ-KTQTKSMPKGPASKGPKLGG 158


>tr|B4FFR7|B4FFR7_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 161

Score = 49.7 bits (117), Expect = 7e-05
Identities = 38/95 (40%), Positives = 47/95 (49%)
Frame = +3

Query: 3 ILAETVKRRRKTTSMPYSRSIVGASLDVIHMILV*KTDLTXXXXXXXXXXXXXPIMKT*D 182
I AE VK+RR+ T PYSRSIVGASL+VI K ++ I KT D
Sbjct: 65 IHAEAVKKRRRATKKPYSRSIVGASLEVIQKKRAEKPEVRDAAREAALREIKERIKKTKD 124

Query: 183 EXXXXXXDLVSYSS*AAALDAMYKGAMLLGPKLDG 287
E + V+ S A A+ KG+ GPKL G
Sbjct: 125 EKKAKKAE-VTKSQKAQTKGAVQKGSK--GPKLGG 156


>tr|B6T1G6|B6T1G6_MAIZE 60S ribosomal protein L24 OS=Zea mays PE=2
SV=1
Length = 161

Score = 49.3 bits (116), Expect = 1e-04
Identities = 38/95 (40%), Positives = 46/95 (48%)
Frame = +3

Query: 3 ILAETVKRRRKTTSMPYSRSIVGASLDVIHMILV*KTDLTXXXXXXXXXXXXXPIMKT*D 182
I AE VK+RR+ T PYSRSIVGASL+VI K ++ I KT D
Sbjct: 65 IHAEAVKKRRRATKKPYSRSIVGASLEVIQKKRAEKPEVRDAAREAALREIKERIKKTKD 124

Query: 183 EXXXXXXDLVSYSS*AAALDAMYKGAMLLGPKLDG 287
E + VS S A+ KG+ GPKL G
Sbjct: 125 EKKAKKAE-VSKSQKTQTKGAVQKGSK--GPKLGG 156


>tr|B6TTC4|B6TTC4_MAIZE 60S ribosomal protein L24 OS=Zea mays PE=2
SV=1
Length = 161

Score = 47.8 bits (112), Expect = 3e-04
Identities = 37/95 (38%), Positives = 46/95 (48%)
Frame = +3

Query: 3 ILAETVKRRRKTTSMPYSRSIVGASLDVIHMILV*KTDLTXXXXXXXXXXXXXPIMKT*D 182
I AE VK+RR+ PYSRSIVGASL+VI K ++ I KT D
Sbjct: 65 IHAEAVKKRRRANKKPYSRSIVGASLEVIQKKRAEKPEVRDAAREAALREIKERIKKTKD 124

Query: 183 EXXXXXXDLVSYSS*AAALDAMYKGAMLLGPKLDG 287
E + V+ S A A+ KG+ GPKL G
Sbjct: 125 EKKAKKAE-VTKSQKAQTKGAVQKGSK--GPKLGG 156