DK943721
Clone id YMU02A01NGRL0003_L20
Library
Length 508
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0003_L20. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
GGGGCTGGGCGTCTCCTTCTTGACCTGCCGTCTAAGGGATATTTCTCGTCAGCTACGAAT
GCTGCCATCTCAGCACCGATGGGCCTTCGCTTATATGTTTGTGATCATGAGACGTCTCCT
CCAGAGCATCAGGTCATTAGAACAGACCGAACAAACATTTTGATAAGGTCATTGACGTTG
AAGAGGTCCAAAAATGATTCAAAAGGGAAACAGAAGCAGAAGCCTGCTGGTGACAGCAAC
AGAGGAAAGAGGCCTGCAGAAAGAGCTGCAGATGACAAGATTGTGTCAAAAAGAGCAAAT
ACAAGTTCTGGATTAAGCAACAATAACAGGAAAGAGAATGGCGGAGCTTGTCCAACTACA
GAGAAAGACTTTCAAGGCTACACTGTTGAGAAATTAAGATCATTGTTGAAGGAACGAAAC
CTGCCACGGACAGGCAAGAAGGACGAGCTCATTGCAAGGTTAAAGCAAAGTTTGATGCAA
TAAATTGGGGCCCAAGGATAATGAATTC
■■Homology search results ■■ -
sp_hit_id P75197
Definition sp|P75197|Y583_MYCPN Uncharacterized protein MPN_583 OS=Mycoplasma pneumoniae
Align length 55
Score (bit) 35.4
E-value 0.16
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943721|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0003_L20, 5'
(508 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P75197|Y583_MYCPN Uncharacterized protein MPN_583 OS=Mycoplas... 35 0.16
sp|P45951|ARP_ARATH Apurinic endonuclease-redox protein OS=Arabi... 35 0.27
sp|Q54N38|UCHL5_DICDI Ubiquitin carboxyl-terminal hydrolase isoz... 33 0.78
sp|Q9VJ87|NCM_DROME Nucampholin OS=Drosophila melanogaster GN=nc... 33 1.0
sp|Q5SRN2|CF010_HUMAN Uncharacterized protein C6orf10 OS=Homo sa... 32 1.3
sp|Q9JIX8|ACINU_MOUSE Apoptotic chromatin condensation inducer i... 32 1.3
sp|Q9UKV3|ACINU_HUMAN Apoptotic chromatin condensation inducer i... 32 1.3
sp|Q5XHX6|TXND2_RAT Thioredoxin domain-containing protein 2 OS=R... 32 1.7
sp|A6R371|PXR1_AJECN Protein PXR1 OS=Ajellomyces capsulata (stra... 32 1.7
sp|Q13427|PPIG_HUMAN Peptidyl-prolyl cis-trans isomerase G OS=Ho... 32 1.7
sp|P39715|ECM1_YEAST Protein ECM1 OS=Saccharomyces cerevisiae GN... 32 1.7
sp|Q7T2A3|DDA1_DANRE DET1- and DDB1-associated protein 1 OS=Dani... 32 1.7
sp|Q9NWB6|ARGL1_HUMAN Arginine and glutamate-rich protein 1 OS=H... 32 1.7
sp|Q2TA42|ARGL1_BOVIN Arginine and glutamate-rich protein 1 OS=B... 32 1.7
sp|Q66GQ2|Y5162_ARATH Uncharacterized protein At5g41620 OS=Arabi... 32 2.3
sp|Q8RHI6|RPOB_FUSNN DNA-directed RNA polymerase subunit beta OS... 32 2.3
sp|Q0U5F2|KU70_PHANO Protein Ku70 OS=Phaeosphaeria nodorum GN=KU... 32 2.3
sp|P40040|THO1_YEAST Protein THO1 OS=Saccharomyces cerevisiae GN... 31 2.9
sp|Q8CH25|SLTM_MOUSE SAFB-like transcription modulator OS=Mus mu... 31 2.9
sp|Q9NWH9|SLTM_HUMAN SAFB-like transcription modulator OS=Homo s... 31 2.9
sp|A5I6G4|PBPA_CLOBH Penicillin-binding protein 1A OS=Clostridiu... 31 2.9
sp|A7FY32|PBPA_CLOB1 Penicillin-binding protein 1A OS=Clostridiu... 31 2.9
sp|O01761|UNC89_CAEEL Muscle M-line assembly protein unc-89 OS=C... 31 3.9
sp|Q7SA95|KU70_NEUCR Protein Ku70 OS=Neurospora crassa GN=ku70 P... 31 3.9
sp|Q9D9Z5|DDA1_MOUSE DET1- and DDB1-associated protein 1 OS=Mus ... 31 3.9
sp|O88453|SAFB1_RAT Scaffold attachment factor B1 OS=Rattus norv... 30 5.0
sp|Q89B20|RPOB_BUCBP DNA-directed RNA polymerase subunit beta OS... 30 5.0
sp|P35729|NU120_YEAST Nucleoporin NUP120 OS=Saccharomyces cerevi... 30 5.0
sp|Q12124|MED2_YEAST Mediator of RNA polymerase II transcription... 30 5.0
sp|P01580|IFNG_MOUSE Interferon gamma OS=Mus musculus GN=Ifng PE... 30 5.0

>sp|P75197|Y583_MYCPN Uncharacterized protein MPN_583 OS=Mycoplasma
pneumoniae GN=MPN_583 PE=3 SV=1
Length = 225

Score = 35.4 bits (80), Expect = 0.16
Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 9/55 (16%)
Frame = +1

Query: 181 KRSKNDSKGKQKQKPAGDSNRGKRPAE---------RAADDKIVSKRANTSSGLS 318
K+ +ND++ K+KQ G++++ K AE + ADDK S ANTS L+
Sbjct: 35 KKKQNDTENKKKQPKDGENDKQKEQAETQPFEWIQQKDADDKKESNTANTSDSLA 89


>sp|P45951|ARP_ARATH Apurinic endonuclease-redox protein
OS=Arabidopsis thaliana GN=ARP PE=2 SV=2
Length = 536

Score = 34.7 bits (78), Expect = 0.27
Identities = 15/51 (29%), Positives = 30/51 (58%)
Frame = +1

Query: 313 LSNNNRKENGGACPTTEKDFQGYTVEKLRSLLKERNLPRTGKKDELIARLK 465
+ ++ ++ G K+ + TV++LRS L++ +P G+K ELI+ L+
Sbjct: 78 MGSDTDRDEMGTLQDDRKEIEAMTVQELRSTLRKLGVPVKGRKQELISTLR 128


>sp|Q54N38|UCHL5_DICDI Ubiquitin carboxyl-terminal hydrolase isozyme
L5 OS=Dictyostelium discoideum GN=uchl5 PE=3 SV=1
Length = 343

Score = 33.1 bits (74), Expect = 0.78
Identities = 23/96 (23%), Positives = 44/96 (45%)
Frame = +1

Query: 133 VIRTDRTNILIRSLTLKRSKNDSKGKQKQKPAGDSNRGKRPAERAADDKIVSKRANTSSG 312
VI+ +T + + LTL++ KND + K + +SG
Sbjct: 216 VIKNRQTTLQEKILTLEKKKND---------------------------LEIKLSELNSG 248

Query: 313 LSNNNRKENGGACPTTEKDFQGYTVEKLRSLLKERN 420
+N++E+GGA PTT++D + + + + ++E N
Sbjct: 249 SGGDNKEESGGATPTTKEDL-NFMINVVNNDIEEAN 283


>sp|Q9VJ87|NCM_DROME Nucampholin OS=Drosophila melanogaster GN=ncm
PE=1 SV=3
Length = 1330

Score = 32.7 bits (73), Expect = 1.0
Identities = 25/93 (26%), Positives = 39/93 (41%)
Frame = +1

Query: 193 NDSKGKQKQKPAGDSNRGKRPAERAADDKIVSKRANTSSGLSNNNRKENGGACPTTEKDF 372
+ S + + S+ K+ +R DK SK+A N+K+ A EK+
Sbjct: 962 SSSDSSSESSSSDSSSEPKKKRKRKDKDKKKSKKATKEKSKKTKNKKKKKKAEKEQEKE- 1020

Query: 373 QGYTVEKLRSLLKERNLPRTGKKDELIARLKQS 471
EK R KE+ + KK+E A K+S
Sbjct: 1021 ----KEKQRKSKKEKEKDKKRKKEEKKAAKKKS 1049


>sp|Q5SRN2|CF010_HUMAN Uncharacterized protein C6orf10 OS=Homo
sapiens GN=C6orf10 PE=1 SV=2
Length = 563

Score = 32.3 bits (72), Expect = 1.3
Identities = 27/111 (24%), Positives = 44/111 (39%), Gaps = 10/111 (9%)
Frame = +1

Query: 34 KGYFSSATNAAISAPMGLRLYVCDHETSPPEHQVIRTDRTNILIRSLTLKRSKNDSKGKQ 213
KG S N +S P L V E+ + Q + + + + K + D++
Sbjct: 452 KGPESQVKNTEVSVPETLESQVKKSESGVLKGQEAQEKKESFEDKGNNDKEKERDAEKDP 511

Query: 214 KQKPAGDSN----------RGKRPAERAADDKIVSKRANTSSGLSNNNRKE 336
+K GD N +GKR +E + SKRA ++G N + E
Sbjct: 512 NKKEKGDKNTKGDKGKDKVKGKRESEINGEKSKGSKRAKANTGRKYNKKVE 562


>sp|Q9JIX8|ACINU_MOUSE Apoptotic chromatin condensation inducer in
the nucleus OS=Mus musculus GN=Acin1 PE=1 SV=2
Length = 1338

Score = 32.3 bits (72), Expect = 1.3
Identities = 15/38 (39%), Positives = 24/38 (63%)
Frame = +1

Query: 364 KDFQGYTVEKLRSLLKERNLPRTGKKDELIARLKQSLM 477
K Q V L++ L++R L ++G+K L+ RLK +LM
Sbjct: 70 KPLQALRVTDLKAALEQRGLAKSGQKSALVKRLKGALM 107


>sp|Q9UKV3|ACINU_HUMAN Apoptotic chromatin condensation inducer in
the nucleus OS=Homo sapiens GN=ACIN1 PE=1 SV=1
Length = 1341

Score = 32.3 bits (72), Expect = 1.3
Identities = 15/38 (39%), Positives = 24/38 (63%)
Frame = +1

Query: 364 KDFQGYTVEKLRSLLKERNLPRTGKKDELIARLKQSLM 477
K Q V L++ L++R L ++G+K L+ RLK +LM
Sbjct: 70 KPLQALRVTDLKAALEQRGLAKSGQKSALVKRLKGALM 107


>sp|Q5XHX6|TXND2_RAT Thioredoxin domain-containing protein 2
OS=Rattus norvegicus GN=Txndc2 PE=1 SV=2
Length = 550

Score = 32.0 bits (71), Expect = 1.7
Identities = 31/132 (23%), Positives = 57/132 (43%), Gaps = 4/132 (3%)
Frame = +1

Query: 22 DLPSKGYFSSATNAAISAPMGLRLYVCDHETSPPEHQVIRTDRTNILIRSLTLKRSKND- 198
D+ +S TN++ + P L + T P + ++ R +S D
Sbjct: 109 DISKTSSYSKQTNSS-NIPKSLAI-----TTYPKQGSTLKPAANGTHDREAEKPKSSEDL 162

Query: 199 --SKGKQKQKPAGDSNRGKR-PAERAADDKIVSKRANTSSGLSNNNRKENGGACPTTEKD 369
SK KP+ DS + K+ ++++D I SK+ +T+ L + + +NG ++E
Sbjct: 163 IQSKKGDIFKPSEDSIQSKKGDMPKSSEDPIQSKKDDTAKSLEDTIQSKNGDMPKSSEDP 222

Query: 370 FQGYTVEKLRSL 405
Q + RSL
Sbjct: 223 IQSKKDDTARSL 234


>sp|A6R371|PXR1_AJECN Protein PXR1 OS=Ajellomyces capsulata (strain
NAm1 / WU24) GN=PXR1 PE=3 SV=1
Length = 320

Score = 32.0 bits (71), Expect = 1.7
Identities = 32/118 (27%), Positives = 52/118 (44%), Gaps = 3/118 (2%)
Frame = +1

Query: 124 EHQVIRTDRTNILIRSLTLKRSKNDSK-GKQKQKPAGDSNRGKR--PAERAADDKIVSKR 294
E + R D T + + + KR + D K K+K+K + DS+ + P+E A DKI KR
Sbjct: 178 EKRRARGDDTGLDLAEQSPKRKRKDRKENKEKKKSSDDSSYANQGTPSEDALVDKIQKKR 237

Query: 295 ANTSSGLSNNNRKENGGACPTTEKDFQGYTVEKLRSLLKERNLPRTGKKDELIARLKQ 468
RK+ TE + RS+ +E R K+E I ++++
Sbjct: 238 ---------KKRKQKDPEPSNTEVHDDSLPPD-TRSVSQEEQESRYSAKNESIRKIRE 285


>sp|Q13427|PPIG_HUMAN Peptidyl-prolyl cis-trans isomerase G OS=Homo
sapiens GN=PPIG PE=1 SV=1
Length = 754

Score = 32.0 bits (71), Expect = 1.7
Identities = 26/109 (23%), Positives = 50/109 (45%)
Frame = +1

Query: 97 VCDHETSPPEHQVIRTDRTNILIRSLTLKRSKNDSKGKQKQKPAGDSNRGKRPAERAADD 276
V DH+++ E + R + ++ KR+K+ S+ K K+K S +R ++ ++
Sbjct: 426 VKDHKSNSKERDIRRNSEKDDKYKNKVKKRAKSKSRSKSKEK----SKSKERDSKHNRNE 481

Query: 277 KIVSKRANTSSGLSNNNRKENGGACPTTEKDFQGYTVEKLRSLLKERNL 423
+ + + S G + N KE + D +G E+ RS K + L
Sbjct: 482 E--KRMRSRSKGRDHENVKEK-----EKQSDSKGKDQERSRSKEKSKQL 523


tr_hit_id A9NKA8
Definition tr|A9NKA8|A9NKA8_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 166
Score (bit) 166.0
E-value 5.0e-40
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943721|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0003_L20, 5'
(508 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NKA8|A9NKA8_PICSI Putative uncharacterized protein OS=Picea... 166 5e-40
tr|A7PHG6|A7PHG6_VITVI Chromosome chr17 scaffold_16, whole genom... 149 8e-35
tr|Q6IDA6|Q6IDA6_ARATH At5g63460 (Putative uncharacterized prote... 138 2e-31
tr|Q3E867|Q3E867_ARATH Uncharacterized protein At5g63460.2 OS=Ar... 136 7e-31
tr|Q2QS19|Q2QS19_ORYSJ Os12g0442900 protein OS=Oryza sativa subs... 133 4e-30
tr|A5ALS5|A5ALS5_VITVI Putative uncharacterized protein OS=Vitis... 130 4e-29
tr|Q2R486|Q2R486_ORYSJ Os11g0483600 protein OS=Oryza sativa subs... 125 2e-27
tr|B8BKI4|B8BKI4_ORYSI Putative uncharacterized protein OS=Oryza... 125 2e-27
tr|Q9FMV6|Q9FMV6_ARATH Genomic DNA, chromosome 5, P1 clone:MLE2 ... 123 4e-27
tr|B8BPH2|B8BPH2_ORYSI Putative uncharacterized protein OS=Oryza... 122 8e-27
tr|B6T3K5|B6T3K5_MAIZE DNA binding protein OS=Zea mays PE=2 SV=1 120 3e-26
tr|B6U5X6|B6U5X6_MAIZE DNA binding protein OS=Zea mays PE=2 SV=1 113 5e-24
tr|A3CBA9|A3CBA9_ORYSJ Putative uncharacterized protein OS=Oryza... 110 4e-23
tr|A3CH07|A3CH07_ORYSJ Putative uncharacterized protein OS=Oryza... 109 7e-23
tr|A9RGW3|A9RGW3_PHYPA Predicted protein (Fragment) OS=Physcomit... 100 7e-20
tr|B6U9P9|B6U9P9_MAIZE DNA binding protein OS=Zea mays PE=2 SV=1 84 4e-15
tr|A8I2A0|A8I2A0_CHLRE Predicted protein OS=Chlamydomonas reinha... 64 6e-09
tr|Q54LM6|Q54LM6_DICDI Putative uncharacterized protein OS=Dicty... 43 0.010
tr|Q8SV91|Q8SV91_ENCCU Putative uncharacterized protein ECU06_12... 42 0.017
tr|B4YIM0|B4YIM0_9EURY Ribosomal protein L32 OS=uncultured marin... 40 0.050
tr|B6U5Z1|B6U5Z1_MAIZE Putative uncharacterized protein OS=Zea m... 40 0.085
tr|B6TE26|B6TE26_MAIZE Putative uncharacterized protein OS=Zea m... 40 0.085
tr|A7F771|A7F771_SCLS1 Putative uncharacterized protein OS=Scler... 39 0.11
tr|B3V6U1|B3V6U1_9EURY Ribosomal protein L32 OS=uncultured marin... 39 0.15
tr|B3V6N4|B3V6N4_9EURY Ribosomal protein L32 OS=uncultured marin... 39 0.15
tr|Q9P6W5|Q9P6W5_NEUCR Putative uncharacterized protein 68B2.110... 39 0.19
tr|Q17AJ4|Q17AJ4_AEDAE Putative uncharacterized protein OS=Aedes... 38 0.25
tr|Q1DZW7|Q1DZW7_COCIM Putative uncharacterized protein OS=Cocci... 38 0.25
tr|A2QD00|A2QD00_ASPNC Similarity to hypothetical protein 68B2.1... 38 0.25
tr|A1ZCQ9|A1ZCQ9_9SPHI Putative uncharacterized protein OS=Micro... 38 0.32

>tr|A9NKA8|A9NKA8_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 186

Score = 166 bits (421), Expect = 5e-40
Identities = 87/166 (52%), Positives = 127/166 (76%), Gaps = 1/166 (0%)
Frame = +1

Query: 1 GAGRLLLDLPSKGYFSSATNAAISAPMGLRLYVCDHETSPPEHQVIRTDRTNILIRSLTL 180
GAG+ L DLPS+G+F++A + S+P GLR+Y+CDH+TSPPE+Q+I+TD TNILIRSLTL
Sbjct: 17 GAGQYLKDLPSRGFFANAVPS--SSPGGLRVYICDHDTSPPENQIIKTDSTNILIRSLTL 74

Query: 181 KRSKNDSKGKQ-KQKPAGDSNRGKRPAERAADDKIVSKRANTSSGLSNNNRKENGGACPT 357
+SK DSK K + A ++++GKRPAER AD+K+++K+A+T G + + K+ GG+
Sbjct: 75 NKSKGDSKLKDVNGRTAAENSKGKRPAERPADEKLIAKKAST--GSNPGSSKKEGGSIQL 132

Query: 358 TEKDFQGYTVEKLRSLLKERNLPRTGKKDELIARLKQSLMQ*IGAQ 495
++++ Q TVE+LRSLL+ER L GKK+ELIARL+Q + +GA+
Sbjct: 133 SDREIQMSTVERLRSLLRERGLSTKGKKEELIARLRQESLA-VGAK 177


>tr|A7PHG6|A7PHG6_VITVI Chromosome chr17 scaffold_16, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00017933001
PE=4 SV=1
Length = 172

Score = 149 bits (376), Expect = 8e-35
Identities = 81/154 (52%), Positives = 109/154 (70%)
Frame = +1

Query: 4 AGRLLLDLPSKGYFSSATNAAISAPMGLRLYVCDHETSPPEHQVIRTDRTNILIRSLTLK 183
A + L++LPS+G FSS + S P G+R+Y+CDHETSPPE Q+I+T++TNILIRSLTLK
Sbjct: 18 ASKYLVNLPSRGLFSSTVIS--SNPGGMRVYICDHETSPPEEQLIKTNQTNILIRSLTLK 75

Query: 184 RSKNDSKGKQKQKPAGDSNRGKRPAERAADDKIVSKRANTSSGLSNNNRKENGGACPTTE 363
+ K DS K + KR AERA D + SKRA T++ S++ R+ +G + T++
Sbjct: 76 KQKGDSSSKDVKGTTAAEVSKKRTAERALDSRSSSKRAMTNA-QSSSRREGSGSSTRTSD 134

Query: 364 KDFQGYTVEKLRSLLKERNLPRTGKKDELIARLK 465
+D+Q TVE+LR+LLKER L GKKDELIARLK
Sbjct: 135 RDYQSLTVERLRALLKERGLSPKGKKDELIARLK 168


>tr|Q6IDA6|Q6IDA6_ARATH At5g63460 (Putative uncharacterized protein
At5g63460) OS=Arabidopsis thaliana GN=At5g63460 PE=2
SV=1
Length = 162

Score = 138 bits (347), Expect = 2e-31
Identities = 76/156 (48%), Positives = 104/156 (66%)
Frame = +1

Query: 4 AGRLLLDLPSKGYFSSATNAAISAPMGLRLYVCDHETSPPEHQVIRTDRTNILIRSLTLK 183
A + L DLPS+G+ SS + S P LR+Y+C+H+TSPPE Q+I+T++ NILIRSL LK
Sbjct: 16 ASKFLSDLPSRGFLSSTVVS--SNPGSLRVYICEHDTSPPEGQLIKTNQQNILIRSLLLK 73

Query: 184 RSKNDSKGKQKQKPAGDSNRGKRPAERAADDKIVSKRANTSSGLSNNNRKENGGACPTTE 363
+ K +S K + A D + KR A RA DD+ +KRA +S ++ G + T E
Sbjct: 74 KQKGESSSKDSKGTAEDGPK-KRAANRALDDRSSAKRAANAS-------RQEGSSSRTGE 125

Query: 364 KDFQGYTVEKLRSLLKERNLPRTGKKDELIARLKQS 471
+DFQ TVEKLR++LKE+ LP G+KDELIARLK +
Sbjct: 126 RDFQSLTVEKLRAMLKEKGLPTKGRKDELIARLKSA 161


>tr|Q3E867|Q3E867_ARATH Uncharacterized protein At5g63460.2
OS=Arabidopsis thaliana GN=At5g63460 PE=4 SV=1
Length = 161

Score = 136 bits (342), Expect = 7e-31
Identities = 76/156 (48%), Positives = 101/156 (64%)
Frame = +1

Query: 4 AGRLLLDLPSKGYFSSATNAAISAPMGLRLYVCDHETSPPEHQVIRTDRTNILIRSLTLK 183
A + L DLPS+G+ SS + S P LR+Y+C+H+TSPPE Q+I+T++ NILIRSL LK
Sbjct: 16 ASKFLSDLPSRGFLSSTVVS--SNPGSLRVYICEHDTSPPEGQLIKTNQQNILIRSLLLK 73

Query: 184 RSKNDSKGKQKQKPAGDSNRGKRPAERAADDKIVSKRANTSSGLSNNNRKENGGACPTTE 363
+ K +S K + A D + KR A RA DD+ +KRA N G + T E
Sbjct: 74 KQKGESSSKDSKGTAEDGPK-KRAANRALDDRSSAKRA--------ANASRQGSSSRTGE 124

Query: 364 KDFQGYTVEKLRSLLKERNLPRTGKKDELIARLKQS 471
+DFQ TVEKLR++LKE+ LP G+KDELIARLK +
Sbjct: 125 RDFQSLTVEKLRAMLKEKGLPTKGRKDELIARLKSA 160


>tr|Q2QS19|Q2QS19_ORYSJ Os12g0442900 protein OS=Oryza sativa subsp.
japonica GN=Os12g0442900 PE=2 SV=2
Length = 178

Score = 133 bits (335), Expect = 4e-30
Identities = 81/156 (51%), Positives = 101/156 (64%)
Frame = +1

Query: 4 AGRLLLDLPSKGYFSSATNAAISAPMGLRLYVCDHETSPPEHQVIRTDRTNILIRSLTLK 183
AG LL LPS+G F ++ S+ GL +YVC H+T+PPE QVI TD TNILIRSL L
Sbjct: 26 AGSLLAGLPSRGNF--VADSIASSMGGLPVYVCLHDTAPPEGQVIDTDTTNILIRSLQLS 83

Query: 184 RSKNDSKGKQKQKPAGDSNRGKRPAERAADDKIVSKRANTSSGLSNNNRKENGGACPTTE 363
+ KN++K + P G+S++GKR A R D K SKRANT S ++ E G +E
Sbjct: 84 KQKNEAKDVGSRTP-GESSKGKRSASRLLDGKNPSKRANTGSTAGSSAHGELGSV--FSE 140

Query: 364 KDFQGYTVEKLRSLLKERNLPRTGKKDELIARLKQS 471
+ Q +TVEKLR LLKER L GKKDELIARL +S
Sbjct: 141 QTLQSFTVEKLRILLKERGLSPKGKKDELIARLIES 176


>tr|A5ALS5|A5ALS5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_028712 PE=4 SV=1
Length = 217

Score = 130 bits (327), Expect = 4e-29
Identities = 73/149 (48%), Positives = 99/149 (66%), Gaps = 3/149 (2%)
Frame = +1

Query: 4 AGRLLLDLPSKGYFSSATNAAISAPMGLRLYVCDHETSPPEHQVIRTDRTNILIRSLTLK 183
A + L++LPS+G FSS + S P G+R+Y+CDHETSPPE Q+I+T++TNILIRSLTLK
Sbjct: 18 ASKYLVNLPSRGLFSSTVIS--SNPGGMRVYICDHETSPPEEQLIKTNQTNILIRSLTLK 75

Query: 184 RSKNDSKGKQKQKPAGDSNRGKRPAERAADDKIVSKRANT---SSGLSNNNRKENGGACP 354
+ K DS K + KR AERA D + SKRA T SS ++ + +G +
Sbjct: 76 KQKGDSSSKDVKGTTAAEVSKKRTAERALDSRSSSKRAMTNAQSSSRRDDFVEGSGSSTR 135

Query: 355 TTEKDFQGYTVEKLRSLLKERNLPRTGKK 441
T+++D+Q TVE+LR+LLKER L GKK
Sbjct: 136 TSDRDYQSLTVERLRALLKERGLSPKGKK 164


>tr|Q2R486|Q2R486_ORYSJ Os11g0483600 protein OS=Oryza sativa subsp.
japonica GN=Os11g0483600 PE=2 SV=1
Length = 185

Score = 125 bits (313), Expect = 2e-27
Identities = 79/165 (47%), Positives = 106/165 (64%), Gaps = 8/165 (4%)
Frame = +1

Query: 1 GAGRLLLDLPSKGYFSSATNAAISAPMG-LRLYVCDHETSPPEHQVIRTDRTNILIRSLT 177
GA + L LPS+G FSS + S+ +G LR+YVC+H+T PPE QVI TD TNILIR L
Sbjct: 26 GAAKFLSGLPSRGNFSSIS---ASSTLGRLRVYVCEHDTDPPEGQVIETDTTNILIRHLQ 82

Query: 178 LKRSKNDSKGKQKQKPAGDSNRG-----KRPAERAADDKIVSKRAN--TSSGLSNNNRKE 336
LK+ + D+K ++ + AG N+G KR A R+ D + SKR N +SSGLS+
Sbjct: 83 LKKKEMDAKEAKEARDAGSRNQGETVKWKRVAPRSLDGQSSSKRPNLGSSSGLSSAEEAA 142

Query: 337 NGGACPTTEKDFQGYTVEKLRSLLKERNLPRTGKKDELIARLKQS 471
G + T Q +TVE+LR+LL++R L GKKDELIARL++S
Sbjct: 143 PGFSGHT----LQTFTVERLRALLRQRGLMTKGKKDELIARLRES 183


>tr|B8BKI4|B8BKI4_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_36116 PE=4 SV=1
Length = 185

Score = 125 bits (313), Expect = 2e-27
Identities = 79/165 (47%), Positives = 106/165 (64%), Gaps = 8/165 (4%)
Frame = +1

Query: 1 GAGRLLLDLPSKGYFSSATNAAISAPMG-LRLYVCDHETSPPEHQVIRTDRTNILIRSLT 177
GA + L LPS+G FSS + S+ +G LR+YVC+H+T PPE QVI TD TNILIR L
Sbjct: 26 GAAKFLSGLPSRGNFSSIS---ASSTLGRLRVYVCEHDTDPPEGQVIETDTTNILIRHLQ 82

Query: 178 LKRSKNDSKGKQKQKPAGDSNRG-----KRPAERAADDKIVSKRAN--TSSGLSNNNRKE 336
LK+ + D+K ++ + AG N+G KR A R+ D + SKR N +SSGLS+
Sbjct: 83 LKKKEMDAKEAKEARDAGSRNQGETVKWKRVAPRSLDGQSSSKRPNLGSSSGLSSAEEAA 142

Query: 337 NGGACPTTEKDFQGYTVEKLRSLLKERNLPRTGKKDELIARLKQS 471
G + T Q +TVE+LR+LL++R L GKKDELIARL++S
Sbjct: 143 PGFSGHT----LQTFTVERLRALLRQRGLMTKGKKDELIARLRES 183


>tr|Q9FMV6|Q9FMV6_ARATH Genomic DNA, chromosome 5, P1 clone:MLE2
OS=Arabidopsis thaliana PE=4 SV=1
Length = 188

Score = 123 bits (309), Expect = 4e-27
Identities = 68/146 (46%), Positives = 95/146 (65%)
Frame = +1

Query: 4 AGRLLLDLPSKGYFSSATNAAISAPMGLRLYVCDHETSPPEHQVIRTDRTNILIRSLTLK 183
A + L DLPS+G+ SS + S P LR+Y+C+H+TSPPE Q+I+T++ NILIRSL LK
Sbjct: 16 ASKFLSDLPSRGFLSSTVVS--SNPGSLRVYICEHDTSPPEGQLIKTNQQNILIRSLLLK 73

Query: 184 RSKNDSKGKQKQKPAGDSNRGKRPAERAADDKIVSKRANTSSGLSNNNRKENGGACPTTE 363
+ K +S K + A D + KR A RA DD+ +KRA +S ++ G + T E
Sbjct: 74 KQKGESSSKDSKGTAEDGPK-KRAANRALDDRSSAKRAANAS-------RQEGSSSRTGE 125

Query: 364 KDFQGYTVEKLRSLLKERNLPRTGKK 441
+DFQ TVEKLR++LKE+ LP G+K
Sbjct: 126 RDFQSLTVEKLRAMLKEKGLPTKGRK 151


>tr|B8BPH2|B8BPH2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_38221 PE=4 SV=1
Length = 187

Score = 122 bits (307), Expect = 8e-27
Identities = 79/162 (48%), Positives = 99/162 (61%), Gaps = 9/162 (5%)
Frame = +1

Query: 13 LLLDLPSKGYFSSATNAAISAPMGLRLYVCDHETSPP---------EHQVIRTDRTNILI 165
LL LPS+G F ++ S+ GL +YVC H+T+PP E QVI TD TNILI
Sbjct: 29 LLAGLPSRGNF--VADSIASSMGGLPIYVCLHDTAPPGMRADCSASEGQVIDTDTTNILI 86

Query: 166 RSLTLKRSKNDSKGKQKQKPAGDSNRGKRPAERAADDKIVSKRANTSSGLSNNNRKENGG 345
RSL L + KN++K + P G+S++GKR A R D K SKRANT S ++ E G
Sbjct: 87 RSLQLSKQKNEAKDVGSRTP-GESSKGKRSASRLLDGKNPSKRANTGSTAGSSAHGELGS 145

Query: 346 ACPTTEKDFQGYTVEKLRSLLKERNLPRTGKKDELIARLKQS 471
+E+ Q +TVEKLR LLKER L GKKDELIARL +S
Sbjct: 146 VF--SEQTLQSFTVEKLRILLKERGLSPKGKKDELIARLIES 185