DK943772
Clone id YMU02A01NGRL0003_O07
Library
Length 567
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0003_O07. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID
Sequence
GAAGCAGTGGTATCAACGCAGAGTGGCCATTACGGCCGGAAAGCAGTGGTATCAACGCAG
AGTGGCCATTACGGCCGGGGATTTCGCATGCGTTTGTCATTTATAAACCCGTTCACCTTC
CTGCTACAGACGGTCAGGAATCGCGATCGCCGTGCTCTAGTGAACTAGCATTCGGAACAC
AGGCCTTGGTGACCTATTTGAACATATCGCTAGAGAATTTTTGGCAAGGCAAACTGGAGC
GTCTAGCTGTTTGGGTGGGGGGCAGCCTTGCCTCTGCATTTTTTGCATCTCTGGAACGGT
GCTCATGCATCAATCTTGAAACAACTGATGCTGATGAAGATGAGGAAGCAGATGGGAAAC
CGTTAATTCCCATGAGCAGGGAGCCTGTACAGCAAGAAAAGTGGGTGCCTGAAATGGTCA
TCCAGATTGATCAAGCCAATGTGGAGCCTTCTCCTTCAAAGTAGCAGCAGGCTTCAAGCT
TGCTTCAATGCACGGACTGAGGGGGCCCTGAAGAAGTGTCAAAGCAGTCGCTTCAACAGA
AAGGCAGTTGCTAGTCTTTCTGCATAG
■■Homology search results ■■ -
sp_hit_id Q66HA2
Definition sp|Q66HA2|CR3L1_RAT cAMP-responsive element-binding protein 3-like protein 1 OS=Rattus norvegicus
Align length 36
Score (bit) 30.8
E-value 3.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943772|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0003_O07, 5'
(488 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q66HA2|CR3L1_RAT cAMP-responsive element-binding protein 3-li... 31 3.4
sp|Q9H6K5|YS027_HUMAN Putative uncharacterized protein FLJ22184 ... 30 7.6
sp|Q9Z125|CR3L1_MOUSE cAMP-responsive element-binding protein 3-... 30 7.6

>sp|Q66HA2|CR3L1_RAT cAMP-responsive element-binding protein 3-like
protein 1 OS=Rattus norvegicus GN=Creb3l1 PE=2 SV=1
Length = 520

Score = 30.8 bits (68), Expect = 3.4
Identities = 14/36 (38%), Positives = 20/36 (55%)
Frame = -1

Query: 479 KTSNCLSVEATALTLLQGPLSPCIEASLKPAATLKE 372
+T CL V A L+ G L+PC+ A + T+KE
Sbjct: 370 QTGTCLMVAALCFVLVLGSLAPCLPAFSSGSKTVKE 405


>sp|Q9H6K5|YS027_HUMAN Putative uncharacterized protein FLJ22184
OS=Homo sapiens PE=2 SV=1
Length = 616

Score = 29.6 bits (65), Expect = 7.6
Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 5/58 (8%)
Frame = -1

Query: 452 ATALTLLQGPLSPCIEASLKPAATLKEKAP-----HWLDQSG*PFQAPTFLAVQAPCS 294
A AL LQ P SP L P AT +AP H L PF P VQAP S
Sbjct: 116 ALALPPLQAPPSPPASPPLSPLATPSPQAPNALAVHLLQA---PFSPPPSPPVQAPFS 170


>sp|Q9Z125|CR3L1_MOUSE cAMP-responsive element-binding protein
3-like protein 1 OS=Mus musculus GN=Creb3l1 PE=2 SV=2
Length = 519

Score = 29.6 bits (65), Expect = 7.6
Identities = 14/36 (38%), Positives = 19/36 (52%)
Frame = -1

Query: 479 KTSNCLSVEATALTLLQGPLSPCIEASLKPAATLKE 372
+T CL V A L+ G L PC+ A + T+KE
Sbjct: 371 QTGTCLMVAALCFVLVLGSLVPCLPAFSSGSMTVKE 406


tr_hit_id A7QWG1
Definition tr|A7QWG1|A7QWG1_VITVI Chromosome undetermined scaffold_203, whole genome shotgun sequence OS=Vitis vinifera
Align length 29
Score (bit) 51.6
E-value 2.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943772|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0003_O07, 5'
(488 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QWG1|A7QWG1_VITVI Chromosome undetermined scaffold_203, who... 52 2e-05
tr|A9NT62|A9NT62_PICSI Putative uncharacterized protein OS=Picea... 51 3e-05
tr|Q9FRG1|Q9FRG1_ORYSJ Expressed protein (Putative uncharacteriz... 50 7e-05
tr|A2XKK7|A2XKK7_ORYSI Putative uncharacterized protein OS=Oryza... 50 7e-05
tr|Q8LNF1|Q8LNF1_ORYSJ Os10g0502100 protein OS=Oryza sativa subs... 47 5e-04
tr|Q6K7R6|Q6K7R6_ORYSJ Os02g0826400 protein OS=Oryza sativa subs... 47 5e-04
tr|B8AF59|B8AF59_ORYSI Putative uncharacterized protein OS=Oryza... 47 5e-04
tr|B6TBS6|B6TBS6_MAIZE Putative uncharacterized protein OS=Zea m... 47 5e-04
tr|B4FGZ8|B4FGZ8_MAIZE Putative uncharacterized protein OS=Zea m... 47 5e-04
tr|A3ACW8|A3ACW8_ORYSJ Putative uncharacterized protein OS=Oryza... 47 5e-04
tr|A2Z926|A2Z926_ORYSI Putative uncharacterized protein OS=Oryza... 47 5e-04
tr|B6T6C1|B6T6C1_MAIZE Putative uncharacterized protein OS=Zea m... 46 0.001
tr|A7QSS2|A7QSS2_VITVI Chromosome chr4 scaffold_162, whole genom... 45 0.001
tr|Q9SN67|Q9SN67_ARATH Putative uncharacterized protein F25I24.2... 45 0.002
tr|A9PCJ9|A9PCJ9_POPTR Putative uncharacterized protein OS=Popul... 44 0.004
tr|A5ANY9|A5ANY9_VITVI Putative uncharacterized protein OS=Vitis... 43 0.007
tr|A9PE30|A9PE30_POPTR Putative uncharacterized protein OS=Popul... 42 0.020
tr|Q0WQ09|Q0WQ09_ARATH Putative uncharacterized protein OS=Arabi... 41 0.026
tr|B6TFH9|B6TFH9_MAIZE Putative uncharacterized protein OS=Zea m... 37 0.38
tr|A9PCD8|A9PCD8_POPTR Putative uncharacterized protein OS=Popul... 37 0.38
tr|Q1QW87|Q1QW87_CHRSD Molybdopterin binding protein OS=Chromoha... 35 2.5
tr|Q2QLP0|Q2QLP0_ORYSJ Os12g0634600 protein OS=Oryza sativa subs... 34 3.2
tr|A2ZN35|A2ZN35_ORYSI Putative uncharacterized protein OS=Oryza... 34 3.2

>tr|A7QWG1|A7QWG1_VITVI Chromosome undetermined scaffold_203, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00008640001 PE=4 SV=1
Length = 147

Score = 51.6 bits (122), Expect = 2e-05
Identities = 23/29 (79%), Positives = 27/29 (93%)
Frame = +2

Query: 152 KLERLAVWVGGSLASAFFASLERCSCINL 238
+L+R+A WVG S+ASAFFASLERCSCINL
Sbjct: 80 RLDRMANWVGTSVASAFFASLERCSCINL 108


>tr|A9NT62|A9NT62_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 122

Score = 50.8 bits (120), Expect = 3e-05
Identities = 25/46 (54%), Positives = 29/46 (63%)
Frame = +2

Query: 152 KLERLAVWVGGSLASAFFASLERCSCINLXXXXXXXXXXXXGKPLI 289
KL+R AVWVG S+ SAFFASLERCSCI L +PL+
Sbjct: 40 KLDRAAVWVGTSVVSAFFASLERCSCITLSNTDTEDEEEAKDRPLM 85


>tr|Q9FRG1|Q9FRG1_ORYSJ Expressed protein (Putative uncharacterized
protein) OS=Oryza sativa subsp. japonica GN=Os03g47210
PE=4 SV=1
Length = 124

Score = 49.7 bits (117), Expect = 7e-05
Identities = 20/28 (71%), Positives = 26/28 (92%)
Frame = +2

Query: 155 LERLAVWVGGSLASAFFASLERCSCINL 238
L+R+A WVGG +A+AFFASLERCSC+N+
Sbjct: 38 LDRVAGWVGGGIAAAFFASLERCSCVNV 65


>tr|A2XKK7|A2XKK7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_12986 PE=4 SV=1
Length = 124

Score = 49.7 bits (117), Expect = 7e-05
Identities = 20/28 (71%), Positives = 26/28 (92%)
Frame = +2

Query: 155 LERLAVWVGGSLASAFFASLERCSCINL 238
L+R+A WVGG +A+AFFASLERCSC+N+
Sbjct: 38 LDRVAGWVGGGIAAAFFASLERCSCVNV 65


>tr|Q8LNF1|Q8LNF1_ORYSJ Os10g0502100 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0078O01.13 PE=4 SV=1
Length = 89

Score = 47.0 bits (110), Expect = 5e-04
Identities = 20/29 (68%), Positives = 25/29 (86%)
Frame = +2

Query: 152 KLERLAVWVGGSLASAFFASLERCSCINL 238
KLE A+WVG S+ASAFFAS+E CSCI++
Sbjct: 16 KLEGYAIWVGASVASAFFASMESCSCIHV 44


>tr|Q6K7R6|Q6K7R6_ORYSJ Os02g0826400 protein OS=Oryza sativa subsp.
japonica GN=P0452F04.17 PE=4 SV=1
Length = 82

Score = 47.0 bits (110), Expect = 5e-04
Identities = 21/28 (75%), Positives = 23/28 (82%)
Frame = +2

Query: 155 LERLAVWVGGSLASAFFASLERCSCINL 238
+E A WVG S+ SAFFASLERCSCINL
Sbjct: 1 MESWASWVGASVTSAFFASLERCSCINL 28


>tr|B8AF59|B8AF59_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_09527 PE=4 SV=1
Length = 82

Score = 47.0 bits (110), Expect = 5e-04
Identities = 21/28 (75%), Positives = 23/28 (82%)
Frame = +2

Query: 155 LERLAVWVGGSLASAFFASLERCSCINL 238
+E A WVG S+ SAFFASLERCSCINL
Sbjct: 1 MESWASWVGASVTSAFFASLERCSCINL 28


>tr|B6TBS6|B6TBS6_MAIZE Putative uncharacterized protein OS=Zea mays
PE=4 SV=1
Length = 92

Score = 47.0 bits (110), Expect = 5e-04
Identities = 21/28 (75%), Positives = 23/28 (82%)
Frame = +2

Query: 155 LERLAVWVGGSLASAFFASLERCSCINL 238
+E A WVG S+ SAFFASLERCSCINL
Sbjct: 1 MESWATWVGTSVTSAFFASLERCSCINL 28


>tr|B4FGZ8|B4FGZ8_MAIZE Putative uncharacterized protein OS=Zea mays
PE=4 SV=1
Length = 83

Score = 47.0 bits (110), Expect = 5e-04
Identities = 21/28 (75%), Positives = 23/28 (82%)
Frame = +2

Query: 155 LERLAVWVGGSLASAFFASLERCSCINL 238
+E A WVG S+ SAFFASLERCSCINL
Sbjct: 1 MESWATWVGTSVTSAFFASLERCSCINL 28


>tr|A3ACW8|A3ACW8_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_008640 PE=4 SV=1
Length = 119

Score = 47.0 bits (110), Expect = 5e-04
Identities = 21/28 (75%), Positives = 23/28 (82%)
Frame = +2

Query: 155 LERLAVWVGGSLASAFFASLERCSCINL 238
+E A WVG S+ SAFFASLERCSCINL
Sbjct: 1 MESWASWVGASVTSAFFASLERCSCINL 28