DK943871
Clone id YMU02A01NGRL0004_D12
Library
Length 607
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0004_D12. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID
Sequence
CTCTCTCTCTCGGTTTTATCTTAATTTTGATAGAGTGAGTGTCGACACTGCTGTGGCCAT
GGCGCTTACGCTCTCTTCCTGCTCTTCGTCCGTGTTGGCTGCCAACACGTCCTCACGACG
CTCGGTTCCCACGTACAACCAGGCGGGTGGCAGCATTGTGAGCTTTGATGGTTTGCGAAT
GAATGATTCACCAAAGGGAATCAGGCTGTCGAGTTTAATTCAGGCACTGTCACATGTCTC
TTTTCATCCCCATGAAAATTCTGCTGCTGTGCTTCCCATCAGAGCAACAACGGCAGAGGC
GCCTCCACTGGCTCTGCCGAAGCAGAAGATTCGAATCAAGCTGAAGTCCTATTGGGTTGA
TCGTATCGAGGAAGCCATAAAGTTGATCCTAGATGCTGCTCGCAGCACTGAGACGAAGAT
TATGGGTCCAGTGCCTCTGCCCACTAGGAGGCGCTTGTATTGTGTGCTGAGGTCCCCCCA
TGTCAATAAGGACTCTAGAGAGCACTTTGAGATACGGACACATCAGCGTCTTATCGATCT
GGAGAACCCAAATGCGGGGACAATTGACGCTNTGATGCAACTGGATATACCAGCTGGAGT
GGACGTG
■■Homology search results ■■ -
sp_hit_id Q9LK61
Definition sp|Q9LK61|RR10_ARATH 30S ribosomal protein S10, chloroplastic OS=Arabidopsis thaliana
Align length 96
Score (bit) 147.0
E-value 5.0e-35
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943871|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0004_D12, 5'
(607 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9LK61|RR10_ARATH 30S ribosomal protein S10, chloroplastic OS... 147 5e-35
sp|Q9M4Y3|RR10_MESCR 30S ribosomal protein S10, chloroplastic OS... 145 2e-34
sp|Q2JUX3|RS10_SYNJA 30S ribosomal protein S10 OS=Synechococcus ... 128 3e-29
sp|Q2JMX6|RS10_SYNJB 30S ribosomal protein S10 OS=Synechococcus ... 125 1e-28
sp|P19460|RR10_GUITH 30S ribosomal protein S10, chloroplastic OS... 124 5e-28
sp|P48852|RS10_SPIPL 30S ribosomal protein S10 OS=Spirulina plat... 122 2e-27
sp|P51286|RR10_PORPU 30S ribosomal protein S10, chloroplastic OS... 122 2e-27
sp|A5IM82|RS10_THEP1 30S ribosomal protein S10 OS=Thermotoga pet... 121 3e-27
sp|P38518|RS10_THEMA 30S ribosomal protein S10 OS=Thermotoga mar... 121 3e-27
sp|Q5N4C2|RS10_SYNP6 30S ribosomal protein S10 OS=Synechococcus ... 121 3e-27
sp|Q31PV6|RS10_SYNE7 30S ribosomal protein S10 OS=Synechococcus ... 121 3e-27
sp|B0JSD9|RS10_MICAN 30S ribosomal protein S10 OS=Microcystis ae... 121 3e-27
sp|P74226|RS10_SYNY3 30S ribosomal protein S10 OS=Synechocystis ... 120 5e-27
sp|Q318N6|RS10_PROM9 30S ribosomal protein S10 OS=Prochlorococcu... 120 5e-27
sp|B0CCC9|RS10_ACAM1 30S ribosomal protein S10 OS=Acaryochloris ... 120 5e-27
sp|Q118Z1|RS10_TRIEI 30S ribosomal protein S10 OS=Trichodesmium ... 120 7e-27
sp|Q3AMT7|RS10_SYNSC 30S ribosomal protein S10 OS=Synechococcus ... 119 9e-27
sp|Q7NEF1|RS10_GLOVI 30S ribosomal protein S10 OS=Gloeobacter vi... 119 9e-27
sp|P17009|RR10_CYAPA Cyanelle 30S ribosomal protein S10 OS=Cyano... 119 9e-27
sp|Q3AW52|RS10_SYNS9 30S ribosomal protein S10 OS=Synechococcus ... 119 1e-26
sp|A5GW15|RS10_SYNR3 30S ribosomal protein S10 OS=Synechococcus ... 119 1e-26
sp|Q46IW5|RS10_PROMT 30S ribosomal protein S10 OS=Prochlorococcu... 119 1e-26
sp|A2C4U4|RS10_PROM1 30S ribosomal protein S10 OS=Prochlorococcu... 119 1e-26
sp|Q1XDK2|RR10_PORYE 30S ribosomal protein S10, chloroplastic OS... 119 1e-26
sp|Q0ID60|RS10_SYNS3 30S ribosomal protein S10 OS=Synechococcus ... 119 2e-26
sp|A5GIN9|RS10_SYNPW 30S ribosomal protein S10 OS=Synechococcus ... 119 2e-26
sp|A2BT82|RS10_PROMS 30S ribosomal protein S10 OS=Prochlorococcu... 119 2e-26
sp|Q7VA06|RS10_PROMA 30S ribosomal protein S10 OS=Prochlorococcu... 119 2e-26
sp|A3PEZ6|RS10_PROM0 30S ribosomal protein S10 OS=Prochlorococcu... 119 2e-26
sp|Q7U4D0|RS10_SYNPX 30S ribosomal protein S10 OS=Synechococcus ... 118 2e-26

>sp|Q9LK61|RR10_ARATH 30S ribosomal protein S10, chloroplastic
OS=Arabidopsis thaliana GN=RPS10 PE=1 SV=1
Length = 191

Score = 147 bits (370), Expect = 5e-35
Identities = 69/96 (71%), Positives = 83/96 (86%)
Frame = +2

Query: 320 KQKIRIKLKSYWVDRIEEAIKLILDAARSTETKIMGPVPLPTRRRLYCVLRSPHVNKDSR 499
KQKIRIKL+SYWV IE++ K ILDAAR+T K MGPVPLPT++R+YCVL+SPHV+KD+R
Sbjct: 92 KQKIRIKLRSYWVPLIEDSCKQILDAARNTNAKTMGPVPLPTKKRIYCVLKSPHVHKDAR 151

Query: 500 EHFEIRTHQRLIDLENPNAGTIDAXMQLDIPAGVDV 607
HFEIRTHQR+ID+ P A TID+ MQLD+PAGVDV
Sbjct: 152 FHFEIRTHQRMIDILYPTAQTIDSLMQLDLPAGVDV 187


>sp|Q9M4Y3|RR10_MESCR 30S ribosomal protein S10, chloroplastic
OS=Mesembryanthemum crystallinum GN=RPS10 PE=1 SV=1
Length = 197

Score = 145 bits (366), Expect = 2e-34
Identities = 68/96 (70%), Positives = 83/96 (86%)
Frame = +2

Query: 320 KQKIRIKLKSYWVDRIEEAIKLILDAARSTETKIMGPVPLPTRRRLYCVLRSPHVNKDSR 499
KQKIRIKL+SYWV IE++ K I+DAAR+T K MGPVPLPT++R++CVL+SPHV+KD+R
Sbjct: 98 KQKIRIKLRSYWVPLIEDSCKQIMDAARTTNAKTMGPVPLPTKKRIFCVLKSPHVHKDAR 157

Query: 500 EHFEIRTHQRLIDLENPNAGTIDAXMQLDIPAGVDV 607
HFEIRTHQRLID+ P A TID+ MQLD+PAGVDV
Sbjct: 158 FHFEIRTHQRLIDILYPTAQTIDSLMQLDLPAGVDV 193


>sp|Q2JUX3|RS10_SYNJA 30S ribosomal protein S10 OS=Synechococcus sp.
(strain JA-3-3Ab) GN=rpsJ PE=3 SV=1
Length = 105

Score = 128 bits (321), Expect = 3e-29
Identities = 59/96 (61%), Positives = 79/96 (82%)
Frame = +2

Query: 320 KQKIRIKLKSYWVDRIEEAIKLILDAARSTETKIMGPVPLPTRRRLYCVLRSPHVNKDSR 499
+QKIRI+LK+Y ++ + I+D AR TE +GP+PLPTRRRLYCVLRSPH +KDSR
Sbjct: 6 QQKIRIRLKAYDHRLLDTSCDKIVDTARRTEAVPVGPIPLPTRRRLYCVLRSPHTDKDSR 65

Query: 500 EHFEIRTHQRLIDLENPNAGTIDAXMQLDIPAGVDV 607
EHFE+RTH+R+ID+ +P++ TIDA M+LD+PAGVD+
Sbjct: 66 EHFEVRTHRRIIDIYSPSSKTIDALMKLDLPAGVDI 101


>sp|Q2JMX6|RS10_SYNJB 30S ribosomal protein S10 OS=Synechococcus sp.
GN=rpsJ PE=3 SV=1
Length = 105

Score = 125 bits (315), Expect = 1e-28
Identities = 57/96 (59%), Positives = 79/96 (82%)
Frame = +2

Query: 320 KQKIRIKLKSYWVDRIEEAIKLILDAARSTETKIMGPVPLPTRRRLYCVLRSPHVNKDSR 499
+QKIRI+LK+Y ++ + I+D AR T+ +GP+PLPTRRR+YCVLRSPH++KDSR
Sbjct: 6 QQKIRIRLKAYDHRLLDTSCDKIVDTARRTDAVPVGPIPLPTRRRIYCVLRSPHIDKDSR 65

Query: 500 EHFEIRTHQRLIDLENPNAGTIDAXMQLDIPAGVDV 607
EHFE RTH+R+ID+ +P++ TIDA M+LD+PAGVD+
Sbjct: 66 EHFETRTHRRIIDIYSPSSKTIDALMKLDLPAGVDI 101


>sp|P19460|RR10_GUITH 30S ribosomal protein S10, chloroplastic
OS=Guillardia theta GN=rps10 PE=3 SV=2
Length = 102

Score = 124 bits (310), Expect = 5e-28
Identities = 55/96 (57%), Positives = 75/96 (78%)
Frame = +2

Query: 320 KQKIRIKLKSYWVDRIEEAIKLILDAARSTETKIMGPVPLPTRRRLYCVLRSPHVNKDSR 499
KQKIRI+LK Y + + ++ I++ A T + GP+PLPTRR++YCVLRSPHVNKDSR
Sbjct: 3 KQKIRIRLKGYETNLLLDSCNKIIETATRTNSVTAGPIPLPTRRKIYCVLRSPHVNKDSR 62

Query: 500 EHFEIRTHQRLIDLENPNAGTIDAXMQLDIPAGVDV 607
EHFE R H+R+ID+ PN+ TID+ M+LD+PAG+D+
Sbjct: 63 EHFETRIHKRVIDIYEPNSTTIDSLMKLDLPAGIDI 98


>sp|P48852|RS10_SPIPL 30S ribosomal protein S10 OS=Spirulina
platensis GN=rpsJ PE=3 SV=1
Length = 105

Score = 122 bits (305), Expect = 2e-27
Identities = 55/96 (57%), Positives = 77/96 (80%)
Frame = +2

Query: 320 KQKIRIKLKSYWVDRIEEAIKLILDAARSTETKIMGPVPLPTRRRLYCVLRSPHVNKDSR 499
+QKIRI+LK++ ++ + + I+D A T +GP+PLPT+RR+YCVLRSPHV+KDSR
Sbjct: 6 QQKIRIRLKAFDRRLLDTSCEKIVDTANRTGATALGPIPLPTKRRIYCVLRSPHVDKDSR 65

Query: 500 EHFEIRTHQRLIDLENPNAGTIDAXMQLDIPAGVDV 607
EHFE RTH+R+ID+ P++ TIDA M+LD+PAGVD+
Sbjct: 66 EHFETRTHRRIIDIYQPSSKTIDALMKLDLPAGVDI 101


>sp|P51286|RR10_PORPU 30S ribosomal protein S10, chloroplastic
OS=Porphyra purpurea GN=rps10 PE=3 SV=1
Length = 105

Score = 122 bits (305), Expect = 2e-27
Identities = 55/94 (58%), Positives = 75/94 (79%)
Frame = +2

Query: 326 KIRIKLKSYWVDRIEEAIKLILDAARSTETKIMGPVPLPTRRRLYCVLRSPHVNKDSREH 505
KIRIKLK+Y + + K I+D A T +GP+PLPT+RR+YCVLRSPHV+KDSREH
Sbjct: 8 KIRIKLKAYNSSLLNTSCKKIVDTAERTNAIAVGPIPLPTKRRIYCVLRSPHVDKDSREH 67

Query: 506 FEIRTHQRLIDLENPNAGTIDAXMQLDIPAGVDV 607
FEIR+H+R+ID+ P++ TIDA M+L++P+GVD+
Sbjct: 68 FEIRSHRRIIDIHQPSSQTIDALMKLNLPSGVDI 101


>sp|A5IM82|RS10_THEP1 30S ribosomal protein S10 OS=Thermotoga
petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995)
GN=rpsJ PE=3 SV=1
Length = 102

Score = 121 bits (303), Expect = 3e-27
Identities = 57/95 (60%), Positives = 77/95 (81%)
Frame = +2

Query: 323 QKIRIKLKSYWVDRIEEAIKLILDAARSTETKIMGPVPLPTRRRLYCVLRSPHVNKDSRE 502
QKIRIKLK+Y + ++E+ K I++ A+ST +K+ GP+PLPT R LYCVLRSP +KDSRE
Sbjct: 4 QKIRIKLKAYDHELLDESAKKIVEVAKSTNSKVSGPIPLPTERTLYCVLRSPMKHKDSRE 63

Query: 503 HFEIRTHQRLIDLENPNAGTIDAXMQLDIPAGVDV 607
HFE R H+RLID+ +P+ TIDA M++++PAGVDV
Sbjct: 64 HFEKRVHKRLIDIIDPSPKTIDALMRINLPAGVDV 98


>sp|P38518|RS10_THEMA 30S ribosomal protein S10 OS=Thermotoga
maritima GN=rpsJ PE=3 SV=1
Length = 102

Score = 121 bits (303), Expect = 3e-27
Identities = 57/95 (60%), Positives = 77/95 (81%)
Frame = +2

Query: 323 QKIRIKLKSYWVDRIEEAIKLILDAARSTETKIMGPVPLPTRRRLYCVLRSPHVNKDSRE 502
QKIRIKLK+Y + ++E+ K I++ A+ST +K+ GP+PLPT R LYCVLRSP +KDSRE
Sbjct: 4 QKIRIKLKAYDHELLDESAKKIVEVAKSTNSKVSGPIPLPTERTLYCVLRSPMKHKDSRE 63

Query: 503 HFEIRTHQRLIDLENPNAGTIDAXMQLDIPAGVDV 607
HFE R H+RLID+ +P+ TIDA M++++PAGVDV
Sbjct: 64 HFEKRVHKRLIDIIDPSPKTIDALMRINLPAGVDV 98


>sp|Q5N4C2|RS10_SYNP6 30S ribosomal protein S10 OS=Synechococcus sp.
(strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rpsJ
PE=3 SV=1
Length = 105

Score = 121 bits (303), Expect = 3e-27
Identities = 55/96 (57%), Positives = 76/96 (79%)
Frame = +2

Query: 320 KQKIRIKLKSYWVDRIEEAIKLILDAARSTETKIMGPVPLPTRRRLYCVLRSPHVNKDSR 499
+QKIRI+LK++ ++ + I++ A T +GP+PLPTRRR+YCVLRSPHV+KDSR
Sbjct: 6 QQKIRIRLKAFDRRLLDTSCDRIVETANRTNATAIGPIPLPTRRRIYCVLRSPHVDKDSR 65

Query: 500 EHFEIRTHQRLIDLENPNAGTIDAXMQLDIPAGVDV 607
EHFE RTH+R+ID+ P++ TIDA M+LD+PAGVD+
Sbjct: 66 EHFETRTHRRIIDIYQPSSKTIDALMKLDLPAGVDI 101


tr_hit_id A9SPM1
Definition tr|A9SPM1|A9SPM1_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 96
Score (bit) 161.0
E-value 2.0e-38
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943871|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0004_D12, 5'
(607 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SPM1|A9SPM1_PHYPA Predicted protein OS=Physcomitrella paten... 161 2e-38
tr|B8LMY6|B8LMY6_PICSI Putative uncharacterized protein OS=Picea... 160 5e-38
tr|A9SV12|A9SV12_PHYPA Predicted protein (Fragment) OS=Physcomit... 160 7e-38
tr|A9NNH5|A9NNH5_PICSI Putative uncharacterized protein OS=Picea... 160 7e-38
tr|Q2V615|Q2V615_BRACM Putative uncharacterized protein OS=Brass... 149 1e-34
tr|A9YUX9|A9YUX9_DAUCA Chloroplast 30S ribosomal protein S10 (Fr... 147 6e-34
tr|A1YMX4|A1YMX4_BRACM 30S ribosomal protein S10-like OS=Brassic... 147 6e-34
tr|Q5MD13|Q5MD13_BRANA 30S ribosomal protein S10-like OS=Brassic... 146 1e-33
tr|A9PJ23|A9PJ23_POPJC Putative uncharacterized protein OS=Popul... 145 1e-33
tr|Q10QH0|Q10QH0_ORYSJ Os03g0196800 protein OS=Oryza sativa subs... 145 2e-33
tr|B8AQ33|B8AQ33_ORYSI Putative uncharacterized protein OS=Oryza... 145 2e-33
tr|B6TFQ9|B6TFQ9_MAIZE Chloroplast 30S ribosomal protein S10 OS=... 144 3e-33
tr|A3AF38|A3AF38_ORYSJ Putative uncharacterized protein OS=Oryza... 143 7e-33
tr|A7Q956|A7Q956_VITVI Chromosome chr19 scaffold_66, whole genom... 142 1e-32
tr|A5BC08|A5BC08_VITVI Putative uncharacterized protein OS=Vitis... 142 1e-32
tr|A6MZG9|A6MZG9_ORYSI Chloroplast 30S ribosomal protein S10 (Fr... 139 1e-31
tr|A4RTZ9|A4RTZ9_OSTLU Plastid ribosomal protein S10 small ribos... 129 1e-28
tr|A6MW29|A6MW29_RHDSA Ribosomal protein S10 OS=Rhodomonas salin... 128 2e-28
tr|B6G641|B6G641_9ACTN Putative uncharacterized protein OS=Colli... 125 1e-27
tr|B6G965|B6G965_9ACTN Putative uncharacterized protein OS=Colli... 124 4e-27
tr|B4VX11|B4VX11_9CYAN Ribosomal protein S10 OS=Microcoleus chth... 124 4e-27
tr|B8HV47|B8HV47_9CHRO Ribosomal protein S10 OS=Cyanothece sp. P... 124 6e-27
tr|B7JUP4|B7JUP4_SYNP8 Ribosomal protein S10 OS=Synechococcus sp... 122 1e-26
tr|B4C014|B4C014_9CHRO Ribosomal protein S10 OS=Cyanothece sp. P... 122 1e-26
tr|B7K833|B7K833_9CHRO Ribosomal protein S10 OS=Cyanothece sp. P... 122 2e-26
tr|B5W7Y0|B5W7Y0_SPIMA Ribosomal protein S10 OS=Arthrospira maxi... 122 2e-26
tr|B4AVR2|B4AVR2_9CHRO Ribosomal protein S10 OS=Cyanothece sp. P... 122 2e-26
tr|Q7XYN4|Q7XYN4_BIGNA Ribosomal protein rpS10 OS=Bigelowiella n... 122 2e-26
tr|B1WQY3|B1WQY3_CYAA5 30S ribosomal protein S10 OS=Cyanothece (... 121 3e-26
tr|Q4C676|Q4C676_CROWT Ribosomal protein S10, bacterial form OS=... 121 3e-26

>tr|A9SPM1|A9SPM1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_133234 PE=4 SV=1
Length = 109

Score = 161 bits (408), Expect = 2e-38
Identities = 76/96 (79%), Positives = 89/96 (92%)
Frame = +2

Query: 320 KQKIRIKLKSYWVDRIEEAIKLILDAARSTETKIMGPVPLPTRRRLYCVLRSPHVNKDSR 499
KQKIRIKL+SYWV+ IE+A + IL+AAR+++ K MGPVPLPT++R+YCVLRSPHVNKDSR
Sbjct: 9 KQKIRIKLRSYWVNLIEQACQQILEAARNSDAKTMGPVPLPTKKRVYCVLRSPHVNKDSR 68

Query: 500 EHFEIRTHQRLIDLENPNAGTIDAXMQLDIPAGVDV 607
EHFEIRTH+RLIDLENPNA TIDA MQLD+PAGVDV
Sbjct: 69 EHFEIRTHRRLIDLENPNAQTIDALMQLDLPAGVDV 104


>tr|B8LMY6|B8LMY6_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 199

Score = 160 bits (405), Expect = 5e-38
Identities = 95/184 (51%), Positives = 120/184 (65%), Gaps = 6/184 (3%)
Frame = +2

Query: 74 SSCSSSV-----LAANTSSRRSVPTYNQAGGSIVS-FDGLRMNDSPKGIRLSSLIQALSH 235
SS SSS L+A++S ++P ++ + + F+GLR N G+ +++ Q+
Sbjct: 17 SSSSSSATKFGSLSASSSLAFNIPNPHRRTQVVFTPFEGLRCNT---GLGTTNVQQSFGK 73

Query: 236 VSFHPHENSAAVLPIRXXXXXXXXXXXXKQKIRIKLKSYWVDRIEEAIKLILDAARSTET 415
+ E + + KQKIRIKL+SYWV IEEA K ILDAARST
Sbjct: 74 LRA---EGRIRPVTVTATSSTAPPLTVPKQKIRIKLRSYWVPLIEEACKQILDAARSTNA 130

Query: 416 KIMGPVPLPTRRRLYCVLRSPHVNKDSREHFEIRTHQRLIDLENPNAGTIDAXMQLDIPA 595
K MGPVPLPT+RR+YCVL+SPHV+KD+REHFE RTHQRLID+ENPNA TIDA MQLDI A
Sbjct: 131 KTMGPVPLPTKRRVYCVLKSPHVHKDAREHFEKRTHQRLIDVENPNAQTIDALMQLDIAA 190

Query: 596 GVDV 607
GVDV
Sbjct: 191 GVDV 194


>tr|A9SV12|A9SV12_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_135694 PE=4 SV=1
Length = 99

Score = 160 bits (404), Expect = 7e-38
Identities = 76/94 (80%), Positives = 87/94 (92%)
Frame = +2

Query: 326 KIRIKLKSYWVDRIEEAIKLILDAARSTETKIMGPVPLPTRRRLYCVLRSPHVNKDSREH 505
KIRIKL+SYWV+ IE+A + IL+AARS+E K MGPVPLPT++R+YCVLRSPHVNKDSREH
Sbjct: 1 KIRIKLRSYWVNLIEQACQQILEAARSSEAKTMGPVPLPTKKRVYCVLRSPHVNKDSREH 60

Query: 506 FEIRTHQRLIDLENPNAGTIDAXMQLDIPAGVDV 607
FEIRTH+RLIDLENPNA TIDA MQLD+PAGVDV
Sbjct: 61 FEIRTHRRLIDLENPNAQTIDALMQLDLPAGVDV 94


>tr|A9NNH5|A9NNH5_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 195

Score = 160 bits (404), Expect = 7e-38
Identities = 95/184 (51%), Positives = 120/184 (65%), Gaps = 5/184 (2%)
Frame = +2

Query: 71 LSSCSSSV----LAANTSSRRSVPTYNQAGGSIVS-FDGLRMNDSPKGIRLSSLIQALSH 235
LSS SS+ L A++S ++P ++ + + F+GLR N G+ +++ Q+
Sbjct: 13 LSSSSSATKFGSLNASSSLAFNIPNPHRRTQVVFTPFEGLRCNT---GLGTTNVQQSFEK 69

Query: 236 VSFHPHENSAAVLPIRXXXXXXXXXXXXKQKIRIKLKSYWVDRIEEAIKLILDAARSTET 415
+ E + + KQKIRIKL+SYWV IEEA K ILDAARST
Sbjct: 70 LRA---EGRIRPVTVTATSSTAPPLTVPKQKIRIKLRSYWVPLIEEACKQILDAARSTNA 126

Query: 416 KIMGPVPLPTRRRLYCVLRSPHVNKDSREHFEIRTHQRLIDLENPNAGTIDAXMQLDIPA 595
K MGPVPLPT+RR+YCVL+SPHV+KD+REHFE RTHQRLID+ENPNA TIDA MQLDI A
Sbjct: 127 KTMGPVPLPTKRRVYCVLKSPHVHKDAREHFEKRTHQRLIDVENPNAQTIDALMQLDIAA 186

Query: 596 GVDV 607
GVDV
Sbjct: 187 GVDV 190


>tr|Q2V615|Q2V615_BRACM Putative uncharacterized protein OS=Brassica
campestris PE=2 SV=1
Length = 190

Score = 149 bits (376), Expect = 1e-34
Identities = 85/179 (47%), Positives = 114/179 (63%), Gaps = 4/179 (2%)
Frame = +2

Query: 83 SSSVLAANTSSRRSVPTYNQAGGSIVSFDGL----RMNDSPKGIRLSSLIQALSHVSFHP 250
SSS S +PT+ G S+++ + R+ +P+ + +L + +S V P
Sbjct: 20 SSSSTRQKLSLLSLLPTHGVTGSSLINKPSVSFTKRIFAAPETLSPETLDEPVSEV---P 76

Query: 251 HENSAAVLPIRXXXXXXXXXXXXKQKIRIKLKSYWVDRIEEAIKLILDAARSTETKIMGP 430
+S +V KQKIRIKL+SYWV IE++ K ILDAAR+T K MGP
Sbjct: 77 SSSSISV---------DADKMAPKQKIRIKLRSYWVPLIEDSCKQILDAARNTNAKTMGP 127

Query: 431 VPLPTRRRLYCVLRSPHVNKDSREHFEIRTHQRLIDLENPNAGTIDAXMQLDIPAGVDV 607
VPLPT++R+YCVL+SPHV+KD+R HFEIRTHQR+ID+ P A TID+ MQLD+PAGVDV
Sbjct: 128 VPLPTKKRIYCVLKSPHVHKDARFHFEIRTHQRMIDILYPTAQTIDSLMQLDLPAGVDV 186


>tr|A9YUX9|A9YUX9_DAUCA Chloroplast 30S ribosomal protein S10
(Fragment) OS=Daucus carota PE=2 SV=1
Length = 101

Score = 147 bits (370), Expect = 6e-34
Identities = 69/96 (71%), Positives = 83/96 (86%)
Frame = +2

Query: 320 KQKIRIKLKSYWVDRIEEAIKLILDAARSTETKIMGPVPLPTRRRLYCVLRSPHVNKDSR 499
KQKIRIKL+SYWV IE++ K I+DAAR+T K MGPVPLPT++R+YCVL+SPHV+KD+R
Sbjct: 2 KQKIRIKLRSYWVPLIEDSCKQIMDAARTTNAKTMGPVPLPTKKRIYCVLKSPHVHKDAR 61

Query: 500 EHFEIRTHQRLIDLENPNAGTIDAXMQLDIPAGVDV 607
HFEIRTHQRLID+ P A TID+ MQLD+PAGVDV
Sbjct: 62 FHFEIRTHQRLIDILYPTAQTIDSLMQLDLPAGVDV 97


>tr|A1YMX4|A1YMX4_BRACM 30S ribosomal protein S10-like OS=Brassica
campestris PE=2 SV=1
Length = 193

Score = 147 bits (370), Expect = 6e-34
Identities = 69/96 (71%), Positives = 83/96 (86%)
Frame = +2

Query: 320 KQKIRIKLKSYWVDRIEEAIKLILDAARSTETKIMGPVPLPTRRRLYCVLRSPHVNKDSR 499
KQKIRIKL+SYWV IE++ K ILDAAR+T K MGPVPLPT++R+YCVL+SPHV+KD+R
Sbjct: 94 KQKIRIKLRSYWVPLIEDSCKQILDAARNTNAKTMGPVPLPTKKRIYCVLKSPHVHKDAR 153

Query: 500 EHFEIRTHQRLIDLENPNAGTIDAXMQLDIPAGVDV 607
HFEIRTHQR+ID+ P A TID+ MQLD+PAGVDV
Sbjct: 154 FHFEIRTHQRMIDILYPTAQTIDSLMQLDLPAGVDV 189


>tr|Q5MD13|Q5MD13_BRANA 30S ribosomal protein S10-like OS=Brassica
napus PE=2 SV=1
Length = 196

Score = 146 bits (368), Expect = 1e-33
Identities = 69/96 (71%), Positives = 82/96 (85%)
Frame = +2

Query: 320 KQKIRIKLKSYWVDRIEEAIKLILDAARSTETKIMGPVPLPTRRRLYCVLRSPHVNKDSR 499
KQKIRIKL+SYWV IE++ K ILDAAR+T K MGPVPLPT++R+YCVL+SPHV+KD+R
Sbjct: 97 KQKIRIKLRSYWVPLIEDSCKQILDAARNTNAKTMGPVPLPTKKRIYCVLKSPHVHKDAR 156

Query: 500 EHFEIRTHQRLIDLENPNAGTIDAXMQLDIPAGVDV 607
HFEIRTHQR+ID+ P A TID MQLD+PAGVDV
Sbjct: 157 FHFEIRTHQRMIDILYPTAQTIDPLMQLDLPAGVDV 192


>tr|A9PJ23|A9PJ23_POPJC Putative uncharacterized protein OS=Populus
jackii PE=2 SV=1
Length = 209

Score = 145 bits (367), Expect = 1e-33
Identities = 69/96 (71%), Positives = 83/96 (86%)
Frame = +2

Query: 320 KQKIRIKLKSYWVDRIEEAIKLILDAARSTETKIMGPVPLPTRRRLYCVLRSPHVNKDSR 499
KQKIRIKL+S+WV IE++ K I+DAAR+T K MGPVPLPT++R+YCVL+SPHV+KD+R
Sbjct: 110 KQKIRIKLRSFWVKLIEDSCKQIMDAARTTNAKTMGPVPLPTKKRVYCVLKSPHVHKDAR 169

Query: 500 EHFEIRTHQRLIDLENPNAGTIDAXMQLDIPAGVDV 607
HFEIRTHQRLID+ P A TID+ MQLDIPAGVDV
Sbjct: 170 FHFEIRTHQRLIDILYPTAQTIDSLMQLDIPAGVDV 205


>tr|Q10QH0|Q10QH0_ORYSJ Os03g0196800 protein OS=Oryza sativa subsp.
japonica GN=Os03g0196800 PE=2 SV=1
Length = 185

Score = 145 bits (366), Expect = 2e-33
Identities = 71/120 (59%), Positives = 86/120 (71%)
Frame = +2

Query: 248 PHENSAAVLPIRXXXXXXXXXXXXKQKIRIKLKSYWVDRIEEAIKLILDAARSTETKIMG 427
P E +P+ KQKIRIKL+SYWV IE++ K I++AA++T K MG
Sbjct: 62 PEETEGTGIPMPSSIGDDGEQLAPKQKIRIKLRSYWVPLIEDSCKKIIEAAKTTNAKTMG 121

Query: 428 PVPLPTRRRLYCVLRSPHVNKDSREHFEIRTHQRLIDLENPNAGTIDAXMQLDIPAGVDV 607
PVPLPT+RR+YCVL SPHV+KDSR HFEIRTHQRLID+ P A TID+ MQL +PAGVDV
Sbjct: 122 PVPLPTKRRVYCVLNSPHVHKDSRFHFEIRTHQRLIDIMYPTAQTIDSLMQLQLPAGVDV 181