DK943880
Clone id YMU02A01NGRL0004_E02
Library
Length 411
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0004_E02. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID
Sequence
GTTGTGTATAAGCCTTTCGCGCTGGGCCTTCTCTACGCAGGCGCGGTCGATCAACTCTTG
CTCCGACAATGAGGGCTAAGTGGAAGAAGAAAAGAATGCGCAGGTTGAAGAGGAAACGCA
GAAAGATGAGGCAGAGATCCAAGTAGGACTTTTGAAGTTTCTATCGGCGCTGAGGGAGCA
TGTGTGGTCTTCTATCTCAATGGAGAGTTTGAGCTGGATCTCTCTCTTGTGAATAGCGTA
GCAGTGACAAGGGATTGATTGCTTCTCTTATACCCTCCCAAGGACGAAGGCCTGCTCTCC
TTCTGGAATATGATTTTGAGTTGTCTTTCATTTTGCCCTTTTGATGAACGCTCTAAGGCT
AACATGAAAACTGGATTATCCNAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id Q3UQN2
Definition sp|Q3UQN2|FCHO2_MOUSE FCH domain only protein 2 OS=Mus musculus
Align length 119
Score (bit) 34.7
E-value 0.15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943880|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0004_E02, 5'
(382 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q3UQN2|FCHO2_MOUSE FCH domain only protein 2 OS=Mus musculus ... 35 0.15
sp|P56698|CAC1B_DISOM Probable voltage-dependent N-type calcium ... 32 1.3
sp|Q555U5|Y4821_DICDI Probable inactive serine/threonine-protein... 31 1.7
sp|O74689|NDE1_EMENI Nuclear distribution protein nudE OS=Emeric... 31 2.2
sp|Q96PM9|Z385A_HUMAN Zinc finger protein 385A OS=Homo sapiens G... 30 3.7
sp|Q5KEK0|PALA_CRYNE pH-response regulator protein palA/RIM20 OS... 29 6.3

>sp|Q3UQN2|FCHO2_MOUSE FCH domain only protein 2 OS=Mus musculus
GN=Fcho2 PE=1 SV=1
Length = 809

Score = 34.7 bits (78), Expect = 0.15
Identities = 33/119 (27%), Positives = 51/119 (42%), Gaps = 4/119 (3%)
Frame = -3

Query: 359 ALERSSKGQNERQLKIIFQKESRPSSLGGYKRSNQSLVTATLFTRERSSSNSPLR*KTTH 180
A+ R S Q R +S+PSSL K +N L LF SS++PL ++
Sbjct: 389 AVSRHSPVQMNRNSSNEELTKSKPSSLPTEKGTNDLLAWDPLFGSSLESSSAPLTSSSSA 448

Query: 179 APSAPIETSKVL----LGSLPHLSAFPLQPAHSFLLPLSPHCRSKS*STAPA*RRPSAK 15
P+ P+ ++ S P L++ L + P SP S +T+P P A+
Sbjct: 449 RPTTPLSLGTLVPPPRPASRPKLASGKLSGINEIPRPFSPPVTS---NTSPPPTAPLAR 504


>sp|P56698|CAC1B_DISOM Probable voltage-dependent N-type calcium
channel subunit alpha-1B OS=Discopyge ommata PE=2 SV=1
Length = 2326

Score = 31.6 bits (70), Expect = 1.3
Identities = 32/114 (28%), Positives = 52/114 (45%), Gaps = 6/114 (5%)
Frame = -3

Query: 350 RSSKGQNERQLKIIFQKESRPSSLGGYKRSNQSLVTATLFTRERSSSNS---PLR*KTTH 180
R S+GQ+E + + ++RP + G ++ + +++ + RSS S L +T
Sbjct: 2204 RLSRGQSEHNHLLSGESQNRPYAGGDSRQPMGTRISSDPYLGFRSSCGSEDLELLEETLT 2263

Query: 179 APSAPIETSKVLLGSLPHLSAFPLQPAHSFLLPLSPHC---RSKS*STAPA*RR 27
A T+ G P S+F QP S +P HC RS STA + R+
Sbjct: 2264 FEVAVAATTAT--GRSPRTSSFTTQPPQSRRVPNGYHCNLGRSTGPSTAASKRK 2315


>sp|Q555U5|Y4821_DICDI Probable inactive serine/threonine-protein
kinase DDB_G0274821 OS=Dictyostelium discoideum
GN=DDB_G0274821 PE=3 SV=1
Length = 854

Score = 31.2 bits (69), Expect = 1.7
Identities = 16/36 (44%), Positives = 22/36 (61%)
Frame = -3

Query: 218 SSSNSPLR*KTTHAPSAPIETSKVLLGSLPHLSAFP 111
SSS P ++ +PS+P TS LL S+P+ S FP
Sbjct: 626 SSSPPPSSSSSSSSPSSPSSTSPSLLSSIPNPSLFP 661


>sp|O74689|NDE1_EMENI Nuclear distribution protein nudE
OS=Emericella nidulans GN=nudE PE=1 SV=1
Length = 586

Score = 30.8 bits (68), Expect = 2.2
Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 2/87 (2%)
Frame = -3

Query: 353 ERSSKGQNERQLKIIFQKESRPSSLGGYKRS-NQSLVTATLFTRERSSSNSPLR*KTTHA 177
ER R+ + + S P + + RS +S V++ LF+ + + L T
Sbjct: 189 ERLRNNNRRRRPAPLGRSPSTPHTPEIFDRSPGESTVSSPLFSTPPTKLSLTLASATATP 248

Query: 176 PSAPI-ETSKVLLGSLPHLSAFPLQPA 99
PS P+ ETS + SL S FPLQ A
Sbjct: 249 PSPPMSETSSSMRKSLTAASGFPLQKA 275


>sp|Q96PM9|Z385A_HUMAN Zinc finger protein 385A OS=Homo sapiens
GN=ZNF385A PE=1 SV=1
Length = 366

Score = 30.0 bits (66), Expect = 3.7
Identities = 28/99 (28%), Positives = 47/99 (47%)
Frame = -3

Query: 365 MLALERSSKGQNERQLKIIFQKESRPSSLGGYKRSNQSLVTATLFTRERSSSNSPLR*KT 186
+L+ + S+G E + F KE P SL G + V A + +++ SPL +
Sbjct: 276 LLSRHKKSRGAGELAGTLTFSKEL-PKSLAGGLLPSPLAVAAVM----AAAAGSPLSLRP 330

Query: 185 THAPSAPIETSKVLLGSLPHLSAFPLQPAHSFLLPLSPH 69
AP+AP+ + L H + P++ AH +L SP+
Sbjct: 331 --APAAPLLQGPPITHPLLHPAPGPIRTAHGPIL-FSPY 366


>sp|Q5KEK0|PALA_CRYNE pH-response regulator protein palA/RIM20
OS=Cryptococcus neoformans GN=RIM20 PE=3 SV=1
Length = 902

Score = 29.3 bits (64), Expect = 6.3
Identities = 22/51 (43%), Positives = 27/51 (52%), Gaps = 2/51 (3%)
Frame = -3

Query: 218 SSSNSPLR*KTTHAPSAPI--ETSKVLLGSLPHLSAFPLQPAHSFLLPLSP 72
S S+SP+R + APSAP E+ L LPH S+ QPA LP P
Sbjct: 785 SFSSSPVR---SPAPSAPARRESPPKTLSFLPHPSSSAWQPASVDFLPPPP 832


tr_hit_id Q6P5W2
Definition tr|Q6P5W2|Q6P5W2_HUMAN LOC400590 protein OS=Homo sapiens
Align length 35
Score (bit) 43.1
E-value 0.007
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943880|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0004_E02, 5'
(382 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q6P5W2|Q6P5W2_HUMAN LOC400590 protein OS=Homo sapiens GN=LOC4... 43 0.007
tr|A0AUP3|A0AUP3_HUMAN LOC339290 protein (Fragment) OS=Homo sapi... 37 0.48
tr|Q3TPU3|Q3TPU3_MOUSE Putative uncharacterized protein OS=Mus m... 35 2.4
tr|A8XH87|A8XH87_CAEBR Putative uncharacterized protein OS=Caeno... 35 2.4
tr|A9V6G6|A9V6G6_MONBE Predicted protein OS=Monosiga brevicollis... 34 3.1
tr|A4HU21|A4HU21_LEIIN Putative uncharacterized protein OS=Leish... 34 3.1
tr|Q9CIW5|Q9CIW5_LACLA Putative uncharacterized protein ycdJ OS=... 34 4.1
tr|B1GBH3|B1GBH3_9BURK Putative uncharacterized protein OS=Burkh... 33 7.0
tr|Q4QHS5|Q4QHS5_LEIMA Putative uncharacterized protein OS=Leish... 33 9.1

>tr|Q6P5W2|Q6P5W2_HUMAN LOC400590 protein OS=Homo sapiens
GN=LOC400590 PE=2 SV=1
Length = 102

Score = 43.1 bits (100), Expect = 0.007
Identities = 19/35 (54%), Positives = 25/35 (71%)
Frame = -3

Query: 173 SAPIETSKVLLGSLPHLSAFPLQPAHSFLLPLSPH 69
++ ++ + LLG LPHLS+F LQPAHS L PL H
Sbjct: 55 ASTVQQASGLLGPLPHLSSFALQPAHSLLPPLGSH 89


>tr|A0AUP3|A0AUP3_HUMAN LOC339290 protein (Fragment) OS=Homo sapiens
GN=LOC339290 PE=2 SV=1
Length = 137

Score = 37.0 bits (84), Expect = 0.48
Identities = 17/26 (65%), Positives = 18/26 (69%)
Frame = -3

Query: 146 LLGSLPHLSAFPLQPAHSFLLPLSPH 69
LLG LPHLS+F QPAHS L L H
Sbjct: 75 LLGPLPHLSSFAFQPAHSLLSLLGSH 100


>tr|Q3TPU3|Q3TPU3_MOUSE Putative uncharacterized protein OS=Mus
musculus GN=Fcho2 PE=1 SV=1
Length = 538

Score = 34.7 bits (78), Expect = 2.4
Identities = 33/119 (27%), Positives = 51/119 (42%), Gaps = 4/119 (3%)
Frame = -3

Query: 359 ALERSSKGQNERQLKIIFQKESRPSSLGGYKRSNQSLVTATLFTRERSSSNSPLR*KTTH 180
A+ R S Q R +S+PSSL K +N L LF SS++PL ++
Sbjct: 118 AVSRHSPVQMNRNSSNEELTKSKPSSLPTEKGTNDLLAWDPLFGSSLESSSAPLTSSSSA 177

Query: 179 APSAPIETSKVL----LGSLPHLSAFPLQPAHSFLLPLSPHCRSKS*STAPA*RRPSAK 15
P+ P+ ++ S P L++ L + P SP S +T+P P A+
Sbjct: 178 RPTTPLSLGTLVPPPRPASRPKLASGKLSGINEIPRPFSPPVTS---NTSPPPTAPLAR 233


>tr|A8XH87|A8XH87_CAEBR Putative uncharacterized protein
OS=Caenorhabditis briggsae GN=CBG13181 PE=4 SV=1
Length = 266

Score = 34.7 bits (78), Expect = 2.4
Identities = 27/98 (27%), Positives = 49/98 (50%), Gaps = 4/98 (4%)
Frame = -3

Query: 335 QNERQLKIIFQKESRPSSLGGYKRSNQSLVTATLFTRE--RSSSNSPLR*KTTHAPS--A 168
+NE+Q++I Q++ +P L + +T + F + R SN+P+ KT+ +PS +
Sbjct: 42 KNEKQIQISAQQKQKPRPL------MEKTITTSSFKEKSNRQKSNAPVSKKTSSSPSTTS 95

Query: 167 PIETSKVLLGSLPHLSAFPLQPAHSFLLPLSPHCRSKS 54
P ++ + P L +P P L+ +P RS S
Sbjct: 96 PRKSPPAMTPYQPPLQ-YPSSPRDLHLVSSTPSSRSSS 132


>tr|A9V6G6|A9V6G6_MONBE Predicted protein OS=Monosiga brevicollis
GN=27937 PE=4 SV=1
Length = 323

Score = 34.3 bits (77), Expect = 3.1
Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 5/61 (8%)
Frame = -3

Query: 317 KIIFQKESRP-----SSLGGYKRSNQSLVTATLFTRERSSSNSPLR*KTTHAPSAPIETS 153
+++F + SRP SS KR+ + + T++ S +P + + T APS P ETS
Sbjct: 254 RLVFNRTSRPTAAAASSTAASKRTKPTSAPSATVTKKAKPSPAPKKHEPTQAPSPPPETS 313

Query: 152 K 150
+
Sbjct: 314 R 314


>tr|A4HU21|A4HU21_LEIIN Putative uncharacterized protein OS=Leishmania
infantum GN=LinJ09.1050 PE=4 SV=1
Length = 5363

Score = 34.3 bits (77), Expect = 3.1
Identities = 25/86 (29%), Positives = 39/86 (45%)
Frame = -3

Query: 332 NERQLKIIFQKESRPSSLGGYKRSNQSLVTATLFTRERSSSNSPLR*KTTHAPSAPIETS 153
+E +L + F S ++G R +QSL +ATL T PS P + S
Sbjct: 1762 SEEELVLSFAVSSGDDTIGTVARRSQSLSSATLHT----------------MPSTPSDRS 1805

Query: 152 KVLLGSLPHLSAFPLQPAHSFLLPLS 75
V ++P +P++PA + LP S
Sbjct: 1806 SVTAAAVPTTIMYPMRPAEA--LPTS 1829


>tr|Q9CIW5|Q9CIW5_LACLA Putative uncharacterized protein ycdJ
OS=Lactococcus lactis subsp. lactis GN=ycdJ PE=4 SV=1
Length = 803

Score = 33.9 bits (76), Expect = 4.1
Identities = 19/60 (31%), Positives = 33/60 (55%)
Frame = -3

Query: 296 SRPSSLGGYKRSNQSLVTATLFTRERSSSNSPLR*KTTHAPSAPIETSKVLLGSLPHLSA 117
S P+S S + +++ + SSS++P T+ APS P+++SK ++G LSA
Sbjct: 93 SSPTSQASLAPSTEGSASSSGVSASMSSSSAPTSSSTSKAPSFPMDSSKAIVGVDSSLSA 152


>tr|B1GBH3|B1GBH3_9BURK Putative uncharacterized protein
OS=Burkholderia graminis C4D1M GN=BgramDRAFT_6710 PE=4
SV=1
Length = 271

Score = 33.1 bits (74), Expect = 7.0
Identities = 17/47 (36%), Positives = 23/47 (48%)
Frame = -3

Query: 176 PSAPIETSKVLLGSLPHLSAFPLQPAHSFLLPLSPHCRSKS*STAPA 36
P+ PIE + + S+P PL P LP PH S+S + PA
Sbjct: 194 PAEPIEPLPLPVDSVPPAEPLPLLPVPELRLPEPPHAPSESSAATPA 240


>tr|Q4QHS5|Q4QHS5_LEIMA Putative uncharacterized protein OS=Leishmania
major GN=LmjF09.0990 PE=4 SV=1
Length = 5381

Score = 32.7 bits (73), Expect = 9.1
Identities = 22/80 (27%), Positives = 36/80 (45%)
Frame = -3

Query: 332 NERQLKIIFQKESRPSSLGGYKRSNQSLVTATLFTRERSSSNSPLR*KTTHAPSAPIETS 153
+E +LK+ S ++G R +QSL +ATL T PS P + S
Sbjct: 1773 SEEELKLGSAVSSGDDTIGTVARRSQSLSSATLHT----------------MPSTPSDRS 1816

Query: 152 KVLLGSLPHLSAFPLQPAHS 93
V ++P +P++PA +
Sbjct: 1817 SVTAAAVPTAIMYPMRPAEA 1836