DK943907
Clone id YMU02A01NGRL0004_F18
Library
Length 353
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0004_F18. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID
Sequence
GATGTTGAGGGTGTATCTAACCTTAATGTGTACACATCTTAAGAGGTGGCAAAAGTGAAG
TTGGAGAAACAAACAACCATTAAAGCCAGAAGTGAAGCATCTTCTTTACAAAAAAATATT
CAAGGATAGGGGTTCAAGCTGCTTAACCTTTCTATTAGCTTTGATGACGCCACTGCTGAT
GCGGATGAGGATATTGCGTATGAATATGAGAGTACTTCATGAGGAAATTTCTGCCGTTCA
CAAGTCCAATTGATTAGTTGGTTTACAAAGCTTCTTAAAAATGGAAAGGTCTCTTACATG
TTTTGCCGAGGTATCTTGTACACTTAATCAAGTAAAATCTAAAGAATGCCTGG
■■Homology search results ■■ -
sp_hit_id P56721
Definition sp|P56721|COLL_DROME Transcription factor collier OS=Drosophila melanogaster
Align length 16
Score (bit) 29.6
E-value 4.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943907|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0004_F18, 5'
(353 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P56721|COLL_DROME Transcription factor collier OS=Drosophila ... 30 4.8

>sp|P56721|COLL_DROME Transcription factor collier OS=Drosophila
melanogaster GN=kn PE=2 SV=2
Length = 575

Score = 29.6 bits (65), Expect = 4.8
Identities = 9/16 (56%), Positives = 11/16 (68%)
Frame = -2

Query: 211 SHIHTQYPHPHQQWRH 164
+H H YPHPHQ W +
Sbjct: 549 AHPHHHYPHPHQPWHN 564


tr_hit_id Q93VK7
Definition tr|Q93VK7|Q93VK7_ARATH AT5g14910/F2G14_30 (Putative uncharacterized protein) OS=Arabidopsis thaliana
Align length 54
Score (bit) 55.5
E-value 1.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943907|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0004_F18, 5'
(353 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q93VK7|Q93VK7_ARATH AT5g14910/F2G14_30 (Putative uncharacteri... 55 1e-06
tr|A7PMF1|A7PMF1_VITVI Chromosome chr14 scaffold_21, whole genom... 49 9e-05
tr|Q5WMQ0|Q5WMQ0_ORYSJ Putative uncharacterized protein OSJNBa00... 49 2e-04
tr|Q0DJ21|Q0DJ21_ORYSJ Os05g0337400 protein OS=Oryza sativa subs... 49 2e-04
tr|A3B2T0|A3B2T0_ORYSJ Putative uncharacterized protein OS=Oryza... 49 2e-04
tr|A2Y3C4|A2Y3C4_ORYSI Putative uncharacterized protein OS=Oryza... 49 2e-04
tr|Q9LFR4|Q9LFR4_ARATH Putative uncharacterized protein F2G14_30... 48 3e-04
tr|B6TI14|B6TI14_MAIZE Putative uncharacterized protein OS=Zea m... 46 0.001
tr|A9S9T8|A9S9T8_PHYPA Predicted protein OS=Physcomitrella paten... 44 0.005
tr|A9T080|A9T080_PHYPA Predicted protein OS=Physcomitrella paten... 42 0.012
tr|A9RV35|A9RV35_PHYPA Predicted protein OS=Physcomitrella paten... 40 0.044
tr|A9NT30|A9NT30_PICSI Putative uncharacterized protein OS=Picea... 38 0.22

>tr|Q93VK7|Q93VK7_ARATH AT5g14910/F2G14_30 (Putative uncharacterized
protein) OS=Arabidopsis thaliana GN=At5g14910 PE=2 SV=1
Length = 178

Score = 55.5 bits (132), Expect = 1e-06
Identities = 30/54 (55%), Positives = 39/54 (72%)
Frame = +1

Query: 1 DVEGVSNLNVYTS*EVAKVKLEKQTTIKARSEASSLQKNIQG*GFKLLNLSISF 162
D++GVSNL V S VA V+L KQTT++A AS+L + IQG GFKL L++SF
Sbjct: 117 DIDGVSNLKVQVSEGVAVVELLKQTTVQATGVASNLVETIQGAGFKLQTLNLSF 170


>tr|A7PMF1|A7PMF1_VITVI Chromosome chr14 scaffold_21, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00020796001
PE=4 SV=1
Length = 153

Score = 49.3 bits (116), Expect = 9e-05
Identities = 26/54 (48%), Positives = 35/54 (64%)
Frame = +1

Query: 1 DVEGVSNLNVYTS*EVAKVKLEKQTTIKARSEASSLQKNIQG*GFKLLNLSISF 162
+ EG++ L V +A V L KQTT++A ASSL + IQG GFKL L++SF
Sbjct: 92 ETEGITTLKVQVVEGIASVALTKQTTVQATGVASSLVETIQGSGFKLQTLNLSF 145


>tr|Q5WMQ0|Q5WMQ0_ORYSJ Putative uncharacterized protein
OSJNBa0053E01.2 OS=Oryza sativa subsp. japonica
GN=OSJNBa0053E01.2 PE=4 SV=1
Length = 536

Score = 48.5 bits (114), Expect = 2e-04
Identities = 27/53 (50%), Positives = 35/53 (66%)
Frame = +1

Query: 4 VEGVSNLNVYTS*EVAKVKLEKQTTIKARSEASSLQKNIQG*GFKLLNLSISF 162
VEGVS+L V + V L K+TT++A AS+L + IQG GFKL LS+SF
Sbjct: 415 VEGVSDLEVLIEEGIGSVVLTKETTVQATGVASNLVEAIQGAGFKLQTLSLSF 467


>tr|Q0DJ21|Q0DJ21_ORYSJ Os05g0337400 protein OS=Oryza sativa subsp.
japonica GN=Os05g0337400 PE=4 SV=1
Length = 346

Score = 48.5 bits (114), Expect = 2e-04
Identities = 27/53 (50%), Positives = 35/53 (66%)
Frame = +1

Query: 4 VEGVSNLNVYTS*EVAKVKLEKQTTIKARSEASSLQKNIQG*GFKLLNLSISF 162
VEGVS+L V + V L K+TT++A AS+L + IQG GFKL LS+SF
Sbjct: 88 VEGVSDLEVLIEEGIGSVVLTKETTVQATGVASNLVEAIQGAGFKLQTLSLSF 140


>tr|A3B2T0|A3B2T0_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_017352 PE=4 SV=1
Length = 160

Score = 48.5 bits (114), Expect = 2e-04
Identities = 27/53 (50%), Positives = 35/53 (66%)
Frame = +1

Query: 4 VEGVSNLNVYTS*EVAKVKLEKQTTIKARSEASSLQKNIQG*GFKLLNLSISF 162
VEGVS+L V + V L K+TT++A AS+L + IQG GFKL LS+SF
Sbjct: 88 VEGVSDLEVLIEEGIGSVVLTKETTVQATGVASNLVEAIQGAGFKLQTLSLSF 140


>tr|A2Y3C4|A2Y3C4_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_19510 PE=4 SV=1
Length = 160

Score = 48.5 bits (114), Expect = 2e-04
Identities = 27/53 (50%), Positives = 35/53 (66%)
Frame = +1

Query: 4 VEGVSNLNVYTS*EVAKVKLEKQTTIKARSEASSLQKNIQG*GFKLLNLSISF 162
VEGVS+L V + V L K+TT++A AS+L + IQG GFKL LS+SF
Sbjct: 88 VEGVSDLEVLIEEGIGSVVLTKETTVQATGVASNLVEAIQGAGFKLQTLSLSF 140


>tr|Q9LFR4|Q9LFR4_ARATH Putative uncharacterized protein F2G14_30
OS=Arabidopsis thaliana GN=F2G14_30 PE=4 SV=1
Length = 175

Score = 47.8 bits (112), Expect = 3e-04
Identities = 28/54 (51%), Positives = 37/54 (68%)
Frame = +1

Query: 1 DVEGVSNLNVYTS*EVAKVKLEKQTTIKARSEASSLQKNIQG*GFKLLNLSISF 162
D++GVSNL V S VA V+ QTT++A AS+L + IQG GFKL L++SF
Sbjct: 117 DIDGVSNLKVQVSEGVAVVE---QTTVQATGVASNLVETIQGAGFKLQTLNLSF 167


>tr|B6TI14|B6TI14_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 161

Score = 45.8 bits (107), Expect = 0.001
Identities = 25/53 (47%), Positives = 34/53 (64%)
Frame = +1

Query: 4 VEGVSNLNVYTS*EVAKVKLEKQTTIKARSEASSLQKNIQG*GFKLLNLSISF 162
+EGV +L V + V L K+TT++A AS+L + IQG GFKL LS+SF
Sbjct: 91 MEGVKDLEVLIEEGIGSVVLTKETTVQATGVASNLVEAIQGAGFKLQTLSLSF 143


>tr|A9S9T8|A9S9T8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_163651 PE=4 SV=1
Length = 236

Score = 43.5 bits (101), Expect = 0.005
Identities = 25/53 (47%), Positives = 32/53 (60%)
Frame = +1

Query: 4 VEGVSNLNVYTS*EVAKVKLEKQTTIKARSEASSLQKNIQG*GFKLLNLSISF 162
+EGVS + VY A V+L KQT I+A ASSL + I GFK+ LS+ F
Sbjct: 157 IEGVSQIKVYVEEGAATVELVKQTDIQATGVASSLVETIVQAGFKIQALSLGF 209


>tr|A9T080|A9T080_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_167413 PE=4 SV=1
Length = 194

Score = 42.4 bits (98), Expect = 0.012
Identities = 25/54 (46%), Positives = 33/54 (61%)
Frame = +1

Query: 1 DVEGVSNLNVYTS*EVAKVKLEKQTTIKARSEASSLQKNIQG*GFKLLNLSISF 162
+ EGVS + VY A V+L KQT I+A ASSL + I+ GFK+ LS+ F
Sbjct: 120 ETEGVSQVKVYVLEGAATVELVKQTDIQATGVASSLVQLIETAGFKMQALSLGF 173