DK943908
Clone id YMU02A01NGRL0004_F19
Library
Length 251
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0004_F19. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID
Sequence
GATTGTGGATTGAGGCCCTTTAAACAGATGCTAGTTAAAAAGACCTGCAAAACTTTTCAG
ATTTACAAACTCTAAAAAAGATTTCTTTTGGCCGTACACAAAACCGTTTTATTTTTTTAG
ACTGCCCGGATTGGTAGAGTCAAATTTAGTACTCATTTTGGTTTTGACTTTGTACACCTT
GCCGTTTCTGATCCAAGATATATCATGCAATTGTTAAGGTTCTGAAAAAAAAAAAAAAAA
ATTAAAAAAAA
■■Homology search results ■■ -
sp_hit_id P76692
Definition sp|P76692|YZGL_ECOLI Putative uncharacterized protein yzgL OS=Escherichia coli (strain K12)
Align length 42
Score (bit) 29.3
E-value 6.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943908|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0004_F19, 5'
(224 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P76692|YZGL_ECOLI Putative uncharacterized protein yzgL OS=Es... 29 6.3
sp|Q8N6G2|CM026_HUMAN Uncharacterized protein C13orf26 OS=Homo s... 29 6.3

>sp|P76692|YZGL_ECOLI Putative uncharacterized protein yzgL
OS=Escherichia coli (strain K12) GN=yzgL PE=5 SV=2
Length = 93

Score = 29.3 bits (64), Expect = 6.3
Identities = 18/42 (42%), Positives = 25/42 (59%)
Frame = +1

Query: 61 IYKL*KRFLLAVHKTVLFF*TARIGRVKFSTHFGFDFVHLAV 186
IY L K F+LA+ +LFF + R+G V + G+D V AV
Sbjct: 51 IYLLLKIFMLALGALMLFF-SGRVGNVPEFCYVGYDGVGFAV 91


>sp|Q8N6G2|CM026_HUMAN Uncharacterized protein C13orf26 OS=Homo
sapiens GN=C13orf26 PE=2 SV=1
Length = 289

Score = 29.3 bits (64), Expect = 6.3
Identities = 15/48 (31%), Positives = 25/48 (52%)
Frame = -3

Query: 198 SWIRNGKVYKVKTKMSTKFDSTNPGSLKK*NGFVYGQKKSFLEFVNLK 55
S++RN + K +T + +D T P L N F Q K +L+ ++ K
Sbjct: 222 SYLRNQEHTKKQTTYQSDYDKTYPDFLMLLNSFTSSQVKEYLQSLSYK 269


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK943908|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0004_F19, 5'
(224 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******