DK944044
Clone id YMU02A01NGRL0004_M22
Library
Length 581
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0004_M22. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
GCATACCAGCGATAAGTAACTTTGCGAGTTTATGGTTCATTTCTCTTTTCTTGTCCATTT
TTGCCACTGGCATATTGGAAATGCGCTGGGGTGGTGTAGGGATCGATGACTGGTGGAGAA
ATGAGCAATTTTGGGTGATTGGAGGTGTCTCTGCTCATCTTTTTGCGGTTTTCCAAGGGC
TTCTCAAGGTTCTTGCAGGTATCGACACAAATTTCACAGTCACTGCGAAGGCAGCGGATG
ATACAGAATTCGGGGAGCTCTACATCTTCAAGTGGACAACCCTTCTTATCCCTCCTACTA
CTTTAATTGTTGTAAATTTGGTAGGTGTAGTGGCAGGCATTTCCGATGCATTAAACAGCG
GATATCAGTCTTGGGGCCCCTTGTTTGGGAAGCTGTTCTTTGCTTTTTAGGTCATAGTTC
ATCTTTATCCTTTCTTGAAAGGATTAATGGGAAGGCAAAACCGCACACCCACAATCGTGA
TTGTGTGGTCGATTCTTCTGGCCTCGATCTTCTCGCTGCTGTGGGTGAGGATTGACCCTT
TCATGAGCCAAACGACAACAACCTCATCACAATGTGGGGAC
■■Homology search results ■■ -
sp_hit_id Q84ZN6
Definition sp|Q84ZN6|CESA8_ORYSJ Probable cellulose synthase A catalytic subunit 8 [UDP-forming] OS=Oryza sativa subsp. japonica
Align length 194
Score (bit) 316.0
E-value 6.0e-86
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944044|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0004_M22, 5'
(581 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q84ZN6|CESA8_ORYSJ Probable cellulose synthase A catalytic su... 316 6e-86
sp|Q84M43|CESA2_ORYSJ Probable cellulose synthase A catalytic su... 313 3e-85
sp|A2XN66|CESA2_ORYSI Probable cellulose synthase A catalytic su... 313 3e-85
sp|Q941L0|CESA3_ARATH Cellulose synthase A catalytic subunit 3 [... 313 4e-85
sp|Q5JN63|CESA4_ORYSJ Cellulose synthase A catalytic subunit 4 [... 307 2e-83
sp|A2WV32|CESA4_ORYSI Cellulose synthase A catalytic subunit 4 [... 307 2e-83
sp|Q9SWW6|CESA7_ARATH Cellulose synthase A catalytic subunit 7 [... 304 2e-82
sp|Q851L8|CESA5_ORYSJ Probable cellulose synthase A catalytic su... 301 1e-81
sp|A2XNT2|CESA5_ORYSI Probable cellulose synthase A catalytic su... 301 1e-81
sp|Q69V23|CESA3_ORYSJ Probable cellulose synthase A catalytic su... 300 3e-81
sp|Q6AT26|CESA1_ORYSJ Probable cellulose synthase A catalytic su... 300 3e-81
sp|A2Y0X2|CESA1_ORYSI Probable cellulose synthase A catalytic su... 300 3e-81
sp|Q6YVM4|CESA6_ORYSJ Probable cellulose synthase A catalytic su... 300 5e-81
sp|Q84JA6|CESA4_ARATH Cellulose synthase A catalytic subunit 4 [... 295 8e-80
sp|Q9AV71|CESA7_ORYSJ Cellulose synthase A catalytic subunit 7 [... 294 2e-79
sp|Q8LPK5|CESA8_ARATH Cellulose synthase A catalytic subunit 8 [... 292 9e-79
sp|O48946|CESA1_ARATH Cellulose synthase A catalytic subunit 1 [... 292 9e-79
sp|Q69P51|CESA9_ORYSJ Cellulose synthase A catalytic subunit 9 [... 291 2e-78
sp|A2Z1C8|CESA9_ORYSI Cellulose synthase A catalytic subunit 9 [... 291 2e-78
sp|Q9SJ22|CESA9_ARATH Probable cellulose synthase A catalytic su... 284 3e-76
sp|Q8L778|CESA5_ARATH Cellulose synthase A catalytic subunit 5 [... 283 3e-76
sp|Q94JQ6|CESA6_ARATH Cellulose synthase A catalytic subunit 6 [... 282 1e-75
sp|Q9SKJ5|CESAA_ARATH Probable cellulose synthase A catalytic su... 278 1e-74
sp|O48947|CESA2_ARATH Cellulose synthase A catalytic subunit 2 [... 278 2e-74
sp|Q9LHZ7|CSLD2_ORYSJ Cellulose synthase-like protein D2 OS=Oryz... 183 5e-46
sp|A2YU42|CSLD2_ORYSI Cellulose synthase-like protein D2 OS=Oryz... 183 5e-46
sp|Q9SRW9|CSLD5_ARATH Cellulose synthase-like protein D5 OS=Arab... 182 8e-46
sp|Q9M9M4|CSLD3_ARATH Cellulose synthase-like protein D3 OS=Arab... 181 2e-45
sp|Q9LFL0|CSLD2_ARATH Cellulose synthase-like protein D2 OS=Arab... 179 7e-45
sp|O49323|CSLD1_ARATH Cellulose synthase-like protein D1 OS=Arab... 179 7e-45

>sp|Q84ZN6|CESA8_ORYSJ Probable cellulose synthase A catalytic subunit
8 [UDP-forming] OS=Oryza sativa subsp. japonica GN=CESA8
PE=2 SV=1
Length = 1081

Score = 316 bits (809), Expect = 6e-86
Identities = 154/194 (79%), Positives = 170/194 (87%), Gaps = 2/194 (1%)
Frame = +3

Query: 3 IPAISNFASLWFISLFLSIFATGILEMRWGGVGIDDWWRNEQFWVIGGVSAHLFAVFQGL 182
IP ISNFAS+WFISLF+SIFATGILEMRW GVGID+WWRNEQFWVIGG+SAHLFAVFQGL
Sbjct: 885 IPEISNFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGL 944

Query: 183 LKVLAGIDTNFTVTAKAAD-DTEFGELYIFKWXXXXXXXXXXXVVNLVGVVAGISDALNS 359
LKVLAGIDTNFTVT+KA+D D +F ELY+FKW ++NLVGVVAGIS A+NS
Sbjct: 945 LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINS 1004

Query: 360 GYQSWGPLFGKLFFAF*VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDP 539
GYQSWGPLFGKLFFAF VIVHLYPFLKGLMGRQNRTPTIV+VW+ILLASIFSLLWVRIDP
Sbjct: 1005 GYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDP 1064

Query: 540 FMSQTTTTSSQ-CG 578
F ++ T +Q CG
Sbjct: 1065 FTTRVTGPDTQTCG 1078


>sp|Q84M43|CESA2_ORYSJ Probable cellulose synthase A catalytic subunit
2 [UDP-forming] OS=Oryza sativa subsp. japonica GN=CESA2
PE=2 SV=1
Length = 1073

Score = 313 bits (803), Expect = 3e-85
Identities = 153/194 (78%), Positives = 170/194 (87%), Gaps = 2/194 (1%)
Frame = +3

Query: 3 IPAISNFASLWFISLFLSIFATGILEMRWGGVGIDDWWRNEQFWVIGGVSAHLFAVFQGL 182
IP ISNFAS+WFISLFLSIFATGILEMRW GVGID+WWRNEQFWVIGG+SAHLFAVFQGL
Sbjct: 877 IPEISNFASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGL 936

Query: 183 LKVLAGIDTNFTVTAKAADDT-EFGELYIFKWXXXXXXXXXXXVVNLVGVVAGISDALNS 359
LKVLAGIDT+FTVT+KA+D+ +F ELY+FKW ++NLVGVVAGIS A+NS
Sbjct: 937 LKVLAGIDTSFTVTSKASDEEGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINS 996

Query: 360 GYQSWGPLFGKLFFAF*VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDP 539
GYQSWGPLFGKLFFAF VIVHLYPFLKGLMGRQNRTPTIV+VW+ILLASIFSLLWVRIDP
Sbjct: 997 GYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDP 1056

Query: 540 FMSQTTTTSSQ-CG 578
F ++ T +Q CG
Sbjct: 1057 FTTRVTGPDTQKCG 1070


>sp|A2XN66|CESA2_ORYSI Probable cellulose synthase A catalytic subunit
2 [UDP-forming] OS=Oryza sativa subsp. indica GN=CESA2
PE=2 SV=1
Length = 1073

Score = 313 bits (803), Expect = 3e-85
Identities = 153/194 (78%), Positives = 170/194 (87%), Gaps = 2/194 (1%)
Frame = +3

Query: 3 IPAISNFASLWFISLFLSIFATGILEMRWGGVGIDDWWRNEQFWVIGGVSAHLFAVFQGL 182
IP ISNFAS+WFISLFLSIFATGILEMRW GVGID+WWRNEQFWVIGG+SAHLFAVFQGL
Sbjct: 877 IPEISNFASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGL 936

Query: 183 LKVLAGIDTNFTVTAKAADDT-EFGELYIFKWXXXXXXXXXXXVVNLVGVVAGISDALNS 359
LKVLAGIDT+FTVT+KA+D+ +F ELY+FKW ++NLVGVVAGIS A+NS
Sbjct: 937 LKVLAGIDTSFTVTSKASDEEGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINS 996

Query: 360 GYQSWGPLFGKLFFAF*VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDP 539
GYQSWGPLFGKLFFAF VIVHLYPFLKGLMGRQNRTPTIV+VW+ILLASIFSLLWVRIDP
Sbjct: 997 GYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDP 1056

Query: 540 FMSQTTTTSSQ-CG 578
F ++ T +Q CG
Sbjct: 1057 FTTRVTGPDTQKCG 1070


>sp|Q941L0|CESA3_ARATH Cellulose synthase A catalytic subunit 3
[UDP-forming] OS=Arabidopsis thaliana GN=CESA3 PE=1 SV=2
Length = 1065

Score = 313 bits (802), Expect = 4e-85
Identities = 151/186 (81%), Positives = 165/186 (88%), Gaps = 1/186 (0%)
Frame = +3

Query: 3 IPAISNFASLWFISLFLSIFATGILEMRWGGVGIDDWWRNEQFWVIGGVSAHLFAVFQGL 182
IP ISN AS+WF+SLFLSIFATGILEMRW GVGID+WWRNEQFWVIGGVSAHLFAVFQG+
Sbjct: 869 IPQISNIASIWFLSLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGI 928

Query: 183 LKVLAGIDTNFTVTAKAAD-DTEFGELYIFKWXXXXXXXXXXXVVNLVGVVAGISDALNS 359
LKVLAGIDTNFTVT+KA+D D +F ELY+FKW +VNLVGVVAG+S A+NS
Sbjct: 929 LKVLAGIDTNFTVTSKASDEDGDFAELYLFKWTTLLIPPTTLLIVNLVGVVAGVSYAINS 988

Query: 360 GYQSWGPLFGKLFFAF*VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDP 539
GYQSWGPLFGKLFFAF VIVHLYPFLKGLMGRQNRTPTIV+VWS+LLASIFSLLWVRIDP
Sbjct: 989 GYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWSVLLASIFSLLWVRIDP 1048

Query: 540 FMSQTT 557
F S+ T
Sbjct: 1049 FTSRVT 1054


>sp|Q5JN63|CESA4_ORYSJ Cellulose synthase A catalytic subunit 4
[UDP-forming] OS=Oryza sativa subsp. japonica GN=CESA4
PE=2 SV=1
Length = 989

Score = 307 bits (787), Expect = 2e-83
Identities = 141/191 (73%), Positives = 167/191 (87%), Gaps = 2/191 (1%)
Frame = +3

Query: 3 IPAISNFASLWFISLFLSIFATGILEMRWGGVGIDDWWRNEQFWVIGGVSAHLFAVFQGL 182
IP +SN A++WF+ LF+SI T +LE+RW G+GI+DWWRNEQFWVIGGVSAHLFAVFQG+
Sbjct: 793 IPTLSNAATIWFLGLFISIIVTSVLELRWSGIGIEDWWRNEQFWVIGGVSAHLFAVFQGI 852

Query: 183 LKVLAGIDTNFTVTAKAADDTEFGELYIFKWXXXXXXXXXXXVVNLVGVVAGISDALNSG 362
LK++AG+DTNFTVTAKA DDTEFGELY+FKW V+NLVGVVAG SDALNSG
Sbjct: 853 LKMIAGLDTNFTVTAKATDDTEFGELYVFKWTTVLIPPTSILVLNLVGVVAGFSDALNSG 912

Query: 363 YQSWGPLFGKLFFAF*VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF 542
Y+SWGPLFGK+FFA VI+HLYPFLKGLMGRQNRTPTIV++WS+LLAS+FSLLWV+IDPF
Sbjct: 913 YESWGPLFGKVFFAMWVIMHLYPFLKGLMGRQNRTPTIVVLWSVLLASVFSLLWVKIDPF 972

Query: 543 M--SQTTTTSS 569
+ S+TTTT+S
Sbjct: 973 IGSSETTTTNS 983


>sp|A2WV32|CESA4_ORYSI Cellulose synthase A catalytic subunit 4
[UDP-forming] OS=Oryza sativa subsp. indica GN=CESA4 PE=2
SV=2
Length = 989

Score = 307 bits (787), Expect = 2e-83
Identities = 141/191 (73%), Positives = 167/191 (87%), Gaps = 2/191 (1%)
Frame = +3

Query: 3 IPAISNFASLWFISLFLSIFATGILEMRWGGVGIDDWWRNEQFWVIGGVSAHLFAVFQGL 182
IP +SN A++WF+ LF+SI T +LE+RW G+GI+DWWRNEQFWVIGGVSAHLFAVFQG+
Sbjct: 793 IPTLSNAATIWFLGLFISIIVTSVLELRWSGIGIEDWWRNEQFWVIGGVSAHLFAVFQGI 852

Query: 183 LKVLAGIDTNFTVTAKAADDTEFGELYIFKWXXXXXXXXXXXVVNLVGVVAGISDALNSG 362
LK++AG+DTNFTVTAKA DDTEFGELY+FKW V+NLVGVVAG SDALNSG
Sbjct: 853 LKMIAGLDTNFTVTAKATDDTEFGELYVFKWTTVLIPPTSILVLNLVGVVAGFSDALNSG 912

Query: 363 YQSWGPLFGKLFFAF*VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF 542
Y+SWGPLFGK+FFA VI+HLYPFLKGLMGRQNRTPTIV++WS+LLAS+FSLLWV+IDPF
Sbjct: 913 YESWGPLFGKVFFAMWVIMHLYPFLKGLMGRQNRTPTIVVLWSVLLASVFSLLWVKIDPF 972

Query: 543 M--SQTTTTSS 569
+ S+TTTT+S
Sbjct: 973 IGSSETTTTNS 983


>sp|Q9SWW6|CESA7_ARATH Cellulose synthase A catalytic subunit 7
[UDP-forming] OS=Arabidopsis thaliana GN=CESA7 PE=1 SV=1
Length = 1026

Score = 304 bits (778), Expect = 2e-82
Identities = 143/193 (74%), Positives = 166/193 (86%), Gaps = 1/193 (0%)
Frame = +3

Query: 3 IPAISNFASLWFISLFLSIFATGILEMRWGGVGIDDWWRNEQFWVIGGVSAHLFAVFQGL 182
+P IS FASL+FISLF+SI TGILE+RW GV I++WWRNEQFWVIGG+SAHLFAV QGL
Sbjct: 831 MPPISTFASLFFISLFMSIIVTGILELRWSGVSIEEWWRNEQFWVIGGISAHLFAVVQGL 890

Query: 183 LKVLAGIDTNFTVTAKAADDTEFGELYIFKWXXXXXXXXXXXVVNLVGVVAGISDALNSG 362
LK+LAGIDTNFTVT+KA DD +FGELY FKW ++N+VGVVAGISDA+N+G
Sbjct: 891 LKILAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTVLIINIVGVVAGISDAINNG 950

Query: 363 YQSWGPLFGKLFFAF*VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF 542
YQSWGPLFGKLFF+F VIVHLYPFLKGLMGRQNRTPTIV++WS+LLASIFSLLWVRIDPF
Sbjct: 951 YQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLASIFSLLWVRIDPF 1010

Query: 543 MSQTT-TTSSQCG 578
+ +T +S+CG
Sbjct: 1011 VLKTKGPDTSKCG 1023


>sp|Q851L8|CESA5_ORYSJ Probable cellulose synthase A catalytic subunit
5 [UDP-forming] OS=Oryza sativa subsp. japonica GN=CESA5
PE=2 SV=1
Length = 1092

Score = 301 bits (772), Expect = 1e-81
Identities = 140/182 (76%), Positives = 160/182 (87%)
Frame = +3

Query: 6 PAISNFASLWFISLFLSIFATGILEMRWGGVGIDDWWRNEQFWVIGGVSAHLFAVFQGLL 185
P ++N ASLWF+SLF+ IFATGILEMRW GVGIDDWWRNEQFWVIGGVS+HLFAVFQGLL
Sbjct: 897 PELTNIASLWFMSLFICIFATGILEMRWSGVGIDDWWRNEQFWVIGGVSSHLFAVFQGLL 956

Query: 186 KVLAGIDTNFTVTAKAADDTEFGELYIFKWXXXXXXXXXXXVVNLVGVVAGISDALNSGY 365
KV+AGIDT+FTVT+K DD EF ELY FKW ++N +GVVAG+S+A+N+GY
Sbjct: 957 KVIAGIDTSFTVTSKGGDDEEFSELYTFKWTTLLIPPTTLLLLNFIGVVAGVSNAINNGY 1016

Query: 366 QSWGPLFGKLFFAF*VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPFM 545
+SWGPLFGKLFFAF VIVHLYPFLKGL+GRQNRTPTIVIVWSILLASIFSLLWVRIDPF+
Sbjct: 1017 ESWGPLFGKLFFAFWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFL 1076

Query: 546 SQ 551
++
Sbjct: 1077 AK 1078


>sp|A2XNT2|CESA5_ORYSI Probable cellulose synthase A catalytic subunit
5 [UDP-forming] OS=Oryza sativa subsp. indica GN=CESA5
PE=2 SV=1
Length = 1092

Score = 301 bits (772), Expect = 1e-81
Identities = 140/182 (76%), Positives = 160/182 (87%)
Frame = +3

Query: 6 PAISNFASLWFISLFLSIFATGILEMRWGGVGIDDWWRNEQFWVIGGVSAHLFAVFQGLL 185
P ++N ASLWF+SLF+ IFATGILEMRW GVGIDDWWRNEQFWVIGGVS+HLFAVFQGLL
Sbjct: 897 PELTNIASLWFMSLFICIFATGILEMRWSGVGIDDWWRNEQFWVIGGVSSHLFAVFQGLL 956

Query: 186 KVLAGIDTNFTVTAKAADDTEFGELYIFKWXXXXXXXXXXXVVNLVGVVAGISDALNSGY 365
KV+AGIDT+FTVT+K DD EF ELY FKW ++N +GVVAG+S+A+N+GY
Sbjct: 957 KVIAGIDTSFTVTSKGGDDEEFSELYTFKWTTLLIPPTTLLLLNFIGVVAGVSNAINNGY 1016

Query: 366 QSWGPLFGKLFFAF*VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPFM 545
+SWGPLFGKLFFAF VIVHLYPFLKGL+GRQNRTPTIVIVWSILLASIFSLLWVRIDPF+
Sbjct: 1017 ESWGPLFGKLFFAFWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFL 1076

Query: 546 SQ 551
++
Sbjct: 1077 AK 1078


>sp|Q69V23|CESA3_ORYSJ Probable cellulose synthase A catalytic subunit
3 [UDP-forming] OS=Oryza sativa subsp. japonica GN=CESA3
PE=2 SV=1
Length = 1093

Score = 300 bits (768), Expect = 3e-81
Identities = 139/182 (76%), Positives = 160/182 (87%)
Frame = +3

Query: 6 PAISNFASLWFISLFLSIFATGILEMRWGGVGIDDWWRNEQFWVIGGVSAHLFAVFQGLL 185
P ++N ASLWF+SLF+ IFATGILEMRW GVGIDDWWRNEQFWVIGGVS+HLFA+FQGLL
Sbjct: 898 PELTNVASLWFMSLFICIFATGILEMRWSGVGIDDWWRNEQFWVIGGVSSHLFALFQGLL 957

Query: 186 KVLAGIDTNFTVTAKAADDTEFGELYIFKWXXXXXXXXXXXVVNLVGVVAGISDALNSGY 365
KV+AGIDT+FTVT+K DD EF ELY FKW ++N +GVVAG+S+A+N+GY
Sbjct: 958 KVIAGIDTSFTVTSKGGDDEEFSELYTFKWTTLLIPPTTLLLLNFIGVVAGVSNAINNGY 1017

Query: 366 QSWGPLFGKLFFAF*VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPFM 545
+SWGPLFGKLFFAF VIVHLYPFLKGL+GRQNRTPTIVIVWSILLASIFSLLWVRIDPF+
Sbjct: 1018 ESWGPLFGKLFFAFWVIVHLYPFLKGLVGRQNRTPTIVIVWSILLASIFSLLWVRIDPFL 1077

Query: 546 SQ 551
++
Sbjct: 1078 AK 1079


tr_hit_id Q6GVM2
Definition tr|Q6GVM2|Q6GVM2_PHYPA Cellulose synthase catalytic subunit (Fragment) OS=Physcomitrella patens
Align length 193
Score (bit) 320.0
E-value 3.0e-86
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944044|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0004_M22, 5'
(581 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q6GVM2|Q6GVM2_PHYPA Cellulose synthase catalytic subunit (Fra... 320 3e-86
tr|A9RUM4|A9RUM4_PHYPA Predicted protein OS=Physcomitrella paten... 320 3e-86
tr|Q9LLI6|Q9LLI6_MAIZE Cellulose synthase-4 OS=Zea mays GN=CesA-... 316 7e-85
tr|Q3Y4F6|Q3Y4F6_PHYPA Cellulose synthase catalytic subunit (Cel... 316 7e-85
tr|Q3Y4F5|Q3Y4F5_PHYPA Cellulose synthase catalytic subunit (Cel... 316 7e-85
tr|Q06FD0|Q06FD0_PHYPA Cellulose synthase 4 OS=Physcomitrella pa... 316 7e-85
tr|Q06FC8|Q06FC8_PHYPA Cellulose synthase 6 OS=Physcomitrella pa... 316 7e-85
tr|Q06FC7|Q06FC7_PHYPA Cellulose synthase 7 OS=Physcomitrella pa... 316 7e-85
tr|B7EKN8|B7EKN8_ORYSJ cDNA clone:J023059I02, full insert sequen... 316 7e-85
tr|A9T9M3|A9T9M3_PHYPA Predicted protein OS=Physcomitrella paten... 316 7e-85
tr|A9SLF9|A9SLF9_PHYPA Cellulose synthase 4, glycosyltransferase... 316 7e-85
tr|A2YJC4|A2YJC4_ORYSI Putative uncharacterized protein OS=Oryza... 316 7e-85
tr|A7Q2A3|A7Q2A3_VITVI Chromosome chr13 scaffold_45, whole genom... 315 9e-85
tr|Q6XP46|Q6XP46_SOLTU Cellulose synthase OS=Solanum tuberosum G... 315 1e-84
tr|Q4U0Z7|Q4U0Z7_BAMOL Cellulose synthase BoCesA4 OS=Bambusa old... 315 2e-84
tr|Q9LLI1|Q9LLI1_MAIZE Cellulose synthase-9 OS=Zea mays GN=CesA-... 314 2e-84
tr|Q4U0Z6|Q4U0Z6_BAMOL Cellulose synthase BoCesA4 (Fragment) OS=... 314 2e-84
tr|Q06FC5|Q06FC5_PHYPA Cellulose synthase 10 (Fragment) OS=Physc... 314 3e-84
tr|A9TE97|A9TE97_PHYPA Cellulose synthase 10, glycosyltransferas... 314 3e-84
tr|P93156|P93156_GOSHI Cellulose synthase (Fragment) OS=Gossypiu... 313 4e-84
tr|A7PWE3|A7PWE3_VITVI Chromosome chr8 scaffold_34, whole genome... 313 4e-84
tr|Q4U0Z5|Q4U0Z5_BAMOL Cellulose synthase BoCesA5 OS=Bambusa old... 313 6e-84
tr|Q8H2C6|Q8H2C6_POPTM Cellulose synthase OS=Populus tremuloides... 312 8e-84
tr|B1NYI9|B1NYI9_EUCGR Cellulose synthase OS=Eucalyptus grandis ... 312 8e-84
tr|B1NYI6|B1NYI6_EUCGR Cellulose synthase OS=Eucalyptus grandis ... 312 8e-84
tr|Q2IB42|Q2IB42_EUCGR Cellulose synthase 2 OS=Eucalyptus grandi... 311 2e-83
tr|B1NYJ0|B1NYJ0_EUCGR Cellulose synthase OS=Eucalyptus grandis ... 311 2e-83
tr|B1NYI7|B1NYI7_EUCGR Cellulose synthase OS=Eucalyptus grandis ... 311 2e-83
tr|A5AVI5|A5AVI5_VITVI Putative uncharacterized protein OS=Vitis... 311 2e-83
tr|A7QPK7|A7QPK7_VITVI Chromosome chr18 scaffold_137, whole geno... 311 2e-83

>tr|Q6GVM2|Q6GVM2_PHYPA Cellulose synthase catalytic subunit
(Fragment) OS=Physcomitrella patens GN=CesA1 PE=4 SV=1
Length = 768

Score = 320 bits (821), Expect = 3e-86
Identities = 153/193 (79%), Positives = 170/193 (88%), Gaps = 1/193 (0%)
Frame = +3

Query: 3 IPAISNFASLWFISLFLSIFATGILEMRWGGVGIDDWWRNEQFWVIGGVSAHLFAVFQGL 182
IP+ISN ASLWFISLF+SIFATGILEMRW GVGID+WWRNEQFWVIGGVSAHLFAVFQGL
Sbjct: 573 IPSISNLASLWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGL 632

Query: 183 LKVLAGIDTNFTVTAKAADDTEFGELYIFKWXXXXXXXXXXXVVNLVGVVAGISDALNSG 362
LKV AGIDTNFTVT+K+++D +FGELY FKW ++NLVGVVAGISDA+N+G
Sbjct: 633 LKVFAGIDTNFTVTSKSSEDEDFGELYAFKWTSLLIPPTTLLIINLVGVVAGISDAINNG 692

Query: 363 YQSWGPLFGKLFFAF*VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF 542
YQ+WGPLFGK+FFAF VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF
Sbjct: 693 YQTWGPLFGKIFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF 752

Query: 543 MSQTTTTS-SQCG 578
+++ T QCG
Sbjct: 753 LTKVTGPDLQQCG 765


>tr|A9RUM4|A9RUM4_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_119553 PE=4 SV=1
Length = 1094

Score = 320 bits (821), Expect = 3e-86
Identities = 153/193 (79%), Positives = 170/193 (88%), Gaps = 1/193 (0%)
Frame = +3

Query: 3 IPAISNFASLWFISLFLSIFATGILEMRWGGVGIDDWWRNEQFWVIGGVSAHLFAVFQGL 182
IP+ISN ASLWFISLF+SIFATGILEMRW GVGID+WWRNEQFWVIGGVSAHLFAVFQGL
Sbjct: 899 IPSISNLASLWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFAVFQGL 958

Query: 183 LKVLAGIDTNFTVTAKAADDTEFGELYIFKWXXXXXXXXXXXVVNLVGVVAGISDALNSG 362
LKV AGIDTNFTVT+K+++D +FGELY FKW ++NLVGVVAGISDA+N+G
Sbjct: 959 LKVFAGIDTNFTVTSKSSEDEDFGELYAFKWTSLLIPPTTLLIINLVGVVAGISDAINNG 1018

Query: 363 YQSWGPLFGKLFFAF*VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF 542
YQ+WGPLFGK+FFAF VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF
Sbjct: 1019 YQTWGPLFGKIFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF 1078

Query: 543 MSQTTTTS-SQCG 578
+++ T QCG
Sbjct: 1079 LTKVTGPDLQQCG 1091


>tr|Q9LLI6|Q9LLI6_MAIZE Cellulose synthase-4 OS=Zea mays GN=CesA-4
PE=2 SV=1
Length = 1077

Score = 316 bits (809), Expect = 7e-85
Identities = 154/194 (79%), Positives = 170/194 (87%), Gaps = 2/194 (1%)
Frame = +3

Query: 3 IPAISNFASLWFISLFLSIFATGILEMRWGGVGIDDWWRNEQFWVIGGVSAHLFAVFQGL 182
IP ISNFAS+WFISLF+SIFATGILEMRW GVGID+WWRNEQFWVIGG+SAHLFAVFQGL
Sbjct: 881 IPEISNFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGL 940

Query: 183 LKVLAGIDTNFTVTAKAAD-DTEFGELYIFKWXXXXXXXXXXXVVNLVGVVAGISDALNS 359
LKVLAGIDTNFTVT+KA+D D +F ELY+FKW ++NLVGVVAGIS A+NS
Sbjct: 941 LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINS 1000

Query: 360 GYQSWGPLFGKLFFAF*VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDP 539
GYQSWGPLFGKLFFAF VIVHLYPFLKGLMGRQNRTPTIV+VW+ILLASIFSLLWVRIDP
Sbjct: 1001 GYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDP 1060

Query: 540 FMSQTTTTSSQ-CG 578
F ++ T +Q CG
Sbjct: 1061 FTTRVTGPDTQTCG 1074


>tr|Q3Y4F6|Q3Y4F6_PHYPA Cellulose synthase catalytic subunit
(Cellulose synthase catalytic subunit CesA6)
OS=Physcomitrella patens GN=CesA6 PE=2 SV=1
Length = 1096

Score = 316 bits (809), Expect = 7e-85
Identities = 152/193 (78%), Positives = 167/193 (86%), Gaps = 1/193 (0%)
Frame = +3

Query: 3 IPAISNFASLWFISLFLSIFATGILEMRWGGVGIDDWWRNEQFWVIGGVSAHLFAVFQGL 182
IP ISN ASLWFISLF+SIFATGILEMRW GVGID+WWRNEQFWVIGGVSAHLFA+FQGL
Sbjct: 901 IPTISNLASLWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFALFQGL 960

Query: 183 LKVLAGIDTNFTVTAKAADDTEFGELYIFKWXXXXXXXXXXXVVNLVGVVAGISDALNSG 362
LKV AGIDTNFTVT+K A+D +F ELY+ KW V+N++GVVAGISDA+N+G
Sbjct: 961 LKVFAGIDTNFTVTSKQAEDEDFAELYMIKWTALLIPPTTLIVINMIGVVAGISDAINNG 1020

Query: 363 YQSWGPLFGKLFFAF*VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF 542
YQSWGPLFGKLFFAF VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF
Sbjct: 1021 YQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF 1080

Query: 543 MSQTTTTS-SQCG 578
+++ SQCG
Sbjct: 1081 LAKVKGPDLSQCG 1093


>tr|Q3Y4F5|Q3Y4F5_PHYPA Cellulose synthase catalytic subunit
(Cellulose synthase catalytic subunit CesA7)
OS=Physcomitrella patens GN=CesA7 PE=2 SV=1
Length = 1096

Score = 316 bits (809), Expect = 7e-85
Identities = 152/193 (78%), Positives = 167/193 (86%), Gaps = 1/193 (0%)
Frame = +3

Query: 3 IPAISNFASLWFISLFLSIFATGILEMRWGGVGIDDWWRNEQFWVIGGVSAHLFAVFQGL 182
IP ISN ASLWFISLF+SIFATGILEMRW GVGID+WWRNEQFWVIGGVSAHLFA+FQGL
Sbjct: 901 IPTISNLASLWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFALFQGL 960

Query: 183 LKVLAGIDTNFTVTAKAADDTEFGELYIFKWXXXXXXXXXXXVVNLVGVVAGISDALNSG 362
LKV AGIDTNFTVT+K A+D +F ELY+ KW V+N++GVVAGISDA+N+G
Sbjct: 961 LKVFAGIDTNFTVTSKQAEDEDFAELYMIKWTALLIPPTTLIVINMIGVVAGISDAINNG 1020

Query: 363 YQSWGPLFGKLFFAF*VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF 542
YQSWGPLFGKLFFAF VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF
Sbjct: 1021 YQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF 1080

Query: 543 MSQTTTTS-SQCG 578
+++ SQCG
Sbjct: 1081 LAKVKGPDLSQCG 1093


>tr|Q06FD0|Q06FD0_PHYPA Cellulose synthase 4 OS=Physcomitrella patens
GN=CesA4 PE=2 SV=1
Length = 1099

Score = 316 bits (809), Expect = 7e-85
Identities = 152/193 (78%), Positives = 167/193 (86%), Gaps = 1/193 (0%)
Frame = +3

Query: 3 IPAISNFASLWFISLFLSIFATGILEMRWGGVGIDDWWRNEQFWVIGGVSAHLFAVFQGL 182
IP ISN ASLWFISLF+SIFATGILEMRW GVGID+WWRNEQFWVIGGVSAHLFA+FQGL
Sbjct: 903 IPTISNLASLWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFALFQGL 962

Query: 183 LKVLAGIDTNFTVTAKAADDTEFGELYIFKWXXXXXXXXXXXVVNLVGVVAGISDALNSG 362
LKV AGIDTNFTVT+K A+D +F ELY+ KW V+N++GVVAGISDA+N+G
Sbjct: 963 LKVFAGIDTNFTVTSKQAEDEDFAELYMIKWTALLIPPTTLLVINMIGVVAGISDAINNG 1022

Query: 363 YQSWGPLFGKLFFAF*VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF 542
YQSWGPLFGKLFFAF VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF
Sbjct: 1023 YQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF 1082

Query: 543 MSQTTTTS-SQCG 578
+++ SQCG
Sbjct: 1083 LAKVKGPDLSQCG 1095


>tr|Q06FC8|Q06FC8_PHYPA Cellulose synthase 6 OS=Physcomitrella patens
GN=CesA6 PE=2 SV=1
Length = 1096

Score = 316 bits (809), Expect = 7e-85
Identities = 152/193 (78%), Positives = 167/193 (86%), Gaps = 1/193 (0%)
Frame = +3

Query: 3 IPAISNFASLWFISLFLSIFATGILEMRWGGVGIDDWWRNEQFWVIGGVSAHLFAVFQGL 182
IP ISN ASLWFISLF+SIFATGILEMRW GVGID+WWRNEQFWVIGGVSAHLFA+FQGL
Sbjct: 901 IPTISNLASLWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFALFQGL 960

Query: 183 LKVLAGIDTNFTVTAKAADDTEFGELYIFKWXXXXXXXXXXXVVNLVGVVAGISDALNSG 362
LKV AGIDTNFTVT+K A+D +F ELY+ KW V+N++GVVAGISDA+N+G
Sbjct: 961 LKVFAGIDTNFTVTSKQAEDEDFAELYMIKWTALLIPPTTLIVINMIGVVAGISDAINNG 1020

Query: 363 YQSWGPLFGKLFFAF*VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF 542
YQSWGPLFGKLFFAF VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF
Sbjct: 1021 YQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF 1080

Query: 543 MSQTTTTS-SQCG 578
+++ SQCG
Sbjct: 1081 LAKVKGPDLSQCG 1093


>tr|Q06FC7|Q06FC7_PHYPA Cellulose synthase 7 OS=Physcomitrella patens
GN=CesA7 PE=2 SV=1
Length = 1096

Score = 316 bits (809), Expect = 7e-85
Identities = 152/193 (78%), Positives = 167/193 (86%), Gaps = 1/193 (0%)
Frame = +3

Query: 3 IPAISNFASLWFISLFLSIFATGILEMRWGGVGIDDWWRNEQFWVIGGVSAHLFAVFQGL 182
IP ISN ASLWFISLF+SIFATGILEMRW GVGID+WWRNEQFWVIGGVSAHLFA+FQGL
Sbjct: 901 IPTISNLASLWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFALFQGL 960

Query: 183 LKVLAGIDTNFTVTAKAADDTEFGELYIFKWXXXXXXXXXXXVVNLVGVVAGISDALNSG 362
LKV AGIDTNFTVT+K A+D +F ELY+ KW V+N++GVVAGISDA+N+G
Sbjct: 961 LKVFAGIDTNFTVTSKQAEDEDFAELYMIKWTALLIPPTTLIVINMIGVVAGISDAINNG 1020

Query: 363 YQSWGPLFGKLFFAF*VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF 542
YQSWGPLFGKLFFAF VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF
Sbjct: 1021 YQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF 1080

Query: 543 MSQTTTTS-SQCG 578
+++ SQCG
Sbjct: 1081 LAKVKGPDLSQCG 1093


>tr|B7EKN8|B7EKN8_ORYSJ cDNA clone:J023059I02, full insert sequence
OS=Oryza sativa subsp. japonica PE=2 SV=1
Length = 1081

Score = 316 bits (809), Expect = 7e-85
Identities = 154/194 (79%), Positives = 170/194 (87%), Gaps = 2/194 (1%)
Frame = +3

Query: 3 IPAISNFASLWFISLFLSIFATGILEMRWGGVGIDDWWRNEQFWVIGGVSAHLFAVFQGL 182
IP ISNFAS+WFISLF+SIFATGILEMRW GVGID+WWRNEQFWVIGG+SAHLFAVFQGL
Sbjct: 885 IPEISNFASIWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGL 944

Query: 183 LKVLAGIDTNFTVTAKAAD-DTEFGELYIFKWXXXXXXXXXXXVVNLVGVVAGISDALNS 359
LKVLAGIDTNFTVT+KA+D D +F ELY+FKW ++NLVGVVAGIS A+NS
Sbjct: 945 LKVLAGIDTNFTVTSKASDEDGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAINS 1004

Query: 360 GYQSWGPLFGKLFFAF*VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDP 539
GYQSWGPLFGKLFFAF VIVHLYPFLKGLMGRQNRTPTIV+VW+ILLASIFSLLWVRIDP
Sbjct: 1005 GYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDP 1064

Query: 540 FMSQTTTTSSQ-CG 578
F ++ T +Q CG
Sbjct: 1065 FTTRVTGPDTQTCG 1078


>tr|A9T9M3|A9T9M3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_192906 PE=4 SV=1
Length = 593

Score = 316 bits (809), Expect = 7e-85
Identities = 152/193 (78%), Positives = 167/193 (86%), Gaps = 1/193 (0%)
Frame = +3

Query: 3 IPAISNFASLWFISLFLSIFATGILEMRWGGVGIDDWWRNEQFWVIGGVSAHLFAVFQGL 182
IP ISN ASLWFISLF+SIFATGILEMRW GVGID+WWRNEQFWVIGGVSAHLFA+FQGL
Sbjct: 398 IPTISNLASLWFISLFISIFATGILEMRWSGVGIDEWWRNEQFWVIGGVSAHLFALFQGL 457

Query: 183 LKVLAGIDTNFTVTAKAADDTEFGELYIFKWXXXXXXXXXXXVVNLVGVVAGISDALNSG 362
LKV AGIDTNFTVT+K A+D +F ELY+ KW V+N++GVVAGISDA+N+G
Sbjct: 458 LKVFAGIDTNFTVTSKQAEDEDFAELYMIKWTALLIPPTTLIVINMIGVVAGISDAINNG 517

Query: 363 YQSWGPLFGKLFFAF*VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF 542
YQSWGPLFGKLFFAF VIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF
Sbjct: 518 YQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVIVWSILLASIFSLLWVRIDPF 577

Query: 543 MSQTTTTS-SQCG 578
+++ SQCG
Sbjct: 578 LAKVKGPDLSQCG 590