DK944130
Clone id YMU02A01NGRL0005_B03
Library
Length 497
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0005_B03. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
GTCTGATATTGATGTATTCATCAGAGGTGGTATCGTGACTTATATTCTATTCATTCTACA
TAGTAGTATAAACGGAATCAATCTGTCTTAGGGTGATCAATTTCTATTTTTATTGGCAGT
ACTTCATTAATTACTATTTCATTAATGAAAAATTAGAAGGTAGATTAATCAATCTCGTCG
CTCACTCCTTTCGCCATCTAGAAAATATATTGACCATTCATTTGTGTTTTGGTACCCCTA
GAAATACTAGGTTGAATTTCTACTTCTCCGTAGAGATAACATGAGAATAAAATCTGTTGG
TATACTTCTAATAAAAATGACTCGGCGTCACTAAACCTTACAGAATAAATCTGGAAGAGA
TTCTTAGAATATTTCAGTACCGATTTGTCAAGATCATAGAACATCTCTTTGGTTGAACCG
CATCCCTCGGTTCATCAACTCGGTGAGATATATTTCCATAAGGGTTTTTTCCTGAATGAA
AACCATCACTAACGAAC
■■Homology search results ■■ -
sp_hit_id Q96BQ3
Definition sp|Q96BQ3|TRI43_HUMAN Tripartite motif-containing protein 43 OS=Homo sapiens
Align length 36
Score (bit) 30.0
E-value 6.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944130|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0005_B03, 5'
(497 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q96BQ3|TRI43_HUMAN Tripartite motif-containing protein 43 OS=... 30 6.1
sp|A6NMD1|T43L2_HUMAN Tripartite motif-containing protein 43-lik... 30 6.1
sp|A6NCK2|T43L1_HUMAN Tripartite motif-containing protein 43-lik... 30 6.1

>sp|Q96BQ3|TRI43_HUMAN Tripartite motif-containing protein 43
OS=Homo sapiens GN=TRIM43 PE=2 SV=1
Length = 446

Score = 30.0 bits (66), Expect = 6.1
Identities = 16/36 (44%), Positives = 24/36 (66%), Gaps = 3/36 (8%)
Frame = -1

Query: 473 RKKPLWKYISPS**TEGCGS---TKEMFYDLDKSVL 375
RK LW+++S + CG+ TK+MF D+DKS+L
Sbjct: 78 RKASLWQFLSSE--KQICGTHRQTKKMFCDMDKSLL 111


>sp|A6NMD1|T43L2_HUMAN Tripartite motif-containing protein 43-like
protein 2 OS=Homo sapiens PE=3 SV=2
Length = 445

Score = 30.0 bits (66), Expect = 6.1
Identities = 16/36 (44%), Positives = 24/36 (66%), Gaps = 3/36 (8%)
Frame = -1

Query: 473 RKKPLWKYISPS**TEGCGS---TKEMFYDLDKSVL 375
RK LW+++S + CG+ TK+MF D+DKS+L
Sbjct: 77 RKASLWQFLSSE--KQICGTHRQTKKMFCDMDKSLL 110


>sp|A6NCK2|T43L1_HUMAN Tripartite motif-containing protein 43-like
protein 1 OS=Homo sapiens PE=3 SV=2
Length = 449

Score = 30.0 bits (66), Expect = 6.1
Identities = 16/36 (44%), Positives = 24/36 (66%), Gaps = 3/36 (8%)
Frame = -1

Query: 473 RKKPLWKYISPS**TEGCGS---TKEMFYDLDKSVL 375
RK LW+++S + CG+ TK+MF D+DKS+L
Sbjct: 78 RKASLWQFLSSE--KQICGTHRQTKKMFCDMDKSLL 111


tr_hit_id B2TNK3
Definition tr|B2TNK3|B2TNK3_CLOBB Putative uncharacterized protein OS=Clostridium botulinum (strain Eklund 17B / type B)
Align length 65
Score (bit) 35.8
E-value 1.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944130|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0005_B03, 5'
(497 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B2TNK3|B2TNK3_CLOBB Putative uncharacterized protein OS=Clost... 36 1.2
tr|B7XK93|B7XK93_9MICR RNA polymerase II transcriptional regulat... 34 4.4
tr|Q6WHX0|Q6WHX0_BPKV4 Putative uncharacterized protein OS=Vibri... 33 5.7
tr|Q4Z1G1|Q4Z1G1_PLABE Putative uncharacterized protein (Fragmen... 33 5.7

>tr|B2TNK3|B2TNK3_CLOBB Putative uncharacterized protein
OS=Clostridium botulinum (strain Eklund 17B / type B)
GN=CLL_A2622 PE=4 SV=1
Length = 256

Score = 35.8 bits (81), Expect = 1.2
Identities = 21/65 (32%), Positives = 30/65 (46%)
Frame = -1

Query: 398 YDLDKSVLKYSKNLFQIYSVRFSDAESFLLEVYQQILFSCYLYGEVEIQPSISRGTKTQM 219
Y+ K +LKY N+F + SD +++L Y + L CY YGE + I G
Sbjct: 73 YETSKELLKYYDNVFSKHITNISDQDAWL--TYSKCLVCCY-YGEFDKAMQILNGINWSS 129

Query: 218 NGQYI 204
YI
Sbjct: 130 KSPYI 134


>tr|B7XK93|B7XK93_9MICR RNA polymerase II transcriptional regulation
mediator OS=Enterocytozoon bieneusi H348 GN=EBI_22311
PE=4 SV=1
Length = 172

Score = 33.9 bits (76), Expect = 4.4
Identities = 17/54 (31%), Positives = 31/54 (57%)
Frame = -1

Query: 404 MFYDLDKSVLKYSKNLFQIYSVRFSDAESFLLEVYQQILFSCYLYGEVEIQPSI 243
+FY+LD+ K++ NLF IY ++ + +LL+ Y ++G + + PSI
Sbjct: 66 IFYELDEEHQKHNANLFIIYKKEHNNGKIYLLKAYY------IMFGYIYVCPSI 113


>tr|Q6WHX0|Q6WHX0_BPKV4 Putative uncharacterized protein OS=Vibrio
phage KVP40 GN=KVP40.0184 PE=4 SV=1
Length = 106

Score = 33.5 bits (75), Expect = 5.7
Identities = 16/41 (39%), Positives = 25/41 (60%)
Frame = -1

Query: 422 CGSTKEMFYDLDKSVLKYSKNLFQIYSVRFSDAESFLLEVY 300
CG E F+ DK+VL+Y + L + S RF + +S+ +VY
Sbjct: 62 CGGCIEDFWSSDKAVLEYGEYLQEHESSRFEEYKSYFPDVY 102


>tr|Q4Z1G1|Q4Z1G1_PLABE Putative uncharacterized protein (Fragment)
OS=Plasmodium berghei GN=PB000384.01.0 PE=4 SV=1
Length = 473

Score = 33.5 bits (75), Expect = 5.7
Identities = 17/64 (26%), Positives = 32/64 (50%)
Frame = +3

Query: 75 ESICLRVINFYFYWQYFINYYFINEKLEGRLINLVAHSFRHLENILTIHLCFGTPRNTRL 254
E ICL Y +Y I++Y + K L+N + F +LE T+++ + + +L
Sbjct: 387 EEICLLEKELELYIKYNISFYRLFFKFIIPLVNKITTIFENLETFFTLYIKYKIKKKKKL 446

Query: 255 NFYF 266
F++
Sbjct: 447 FFFY 450