DK944259
Clone id YMU02A01NGRL0005_H14
Library
Length 546
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0005_H14. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
GATATCTAGTTTTTCCAGTTTTCCGTTTGATGCCTTCAGGCCTGCTATGTAAGCAGTGAT
GTACTTGCCCTCAGAATAGGCACCATTTGGGCGTTACAAGTAATAGAATCAGCCTCTTTT
TCTTGGGGGGGAAAAAGGTCCTTCCTGTGGCGTTAAGGCAGGTCTTTGATGCACCGAAGC
TCTTCTCCGGCATAAATTATGTTGGGTGTGGAAGACTTGATGAAGGAAGAAGATTGTAAT
ATAAATCCAGTCTCAAGGAAGTGGCACAACTGGCAACACATGTGGGGGTGCTCTCTTGTT
GTTTAGGCTGGAGCGAAACTCACTTCGTCTATGCTGGAGCTGCATACGTTGTAAGGGCCT
CAGCTAGATTCATGCCATCATCATGTACACCAATCATGTCCTGAAGGGTTGTAGCCTGTT
AACTATGTGATCATAACTCTTGAACATTATTCCACGAGGTGCTGTATCATTCAGATGAAC
ATCCCCTCAAAAGTTGAATTGATTCCTTTAGTTTTCTAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA
■■Homology search results ■■ -
sp_hit_id A2BQ40
Definition sp|A2BQ40|GLO2_PROMS Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain AS9601)
Align length 83
Score (bit) 32.0
E-value 1.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944259|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0005_H14, 5'
(517 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A2BQ40|GLO2_PROMS Hydroxyacylglutathione hydrolase OS=Prochlo... 32 1.8
sp|A3PBT3|GLO2_PROM0 Hydroxyacylglutathione hydrolase OS=Prochlo... 32 2.3
sp|Q4K6J3|MURG_PSEF5 UDP-N-acetylglucosamine--N-acetylmuramyl-(p... 31 3.0
sp|Q1LT01|GLO2_BAUCH Hydroxyacylglutathione hydrolase OS=Baumann... 31 3.0
sp|Q31BX5|GLO2_PROM9 Hydroxyacylglutathione hydrolase OS=Prochlo... 30 5.1
sp|A8GA75|GLO2_SERP5 Hydroxyacylglutathione hydrolase OS=Serrati... 30 6.7

>sp|A2BQ40|GLO2_PROMS Hydroxyacylglutathione hydrolase
OS=Prochlorococcus marinus (strain AS9601) GN=gloB PE=3
SV=2
Length = 246

Score = 32.0 bits (71), Expect = 1.8
Identities = 26/83 (31%), Positives = 40/83 (48%)
Frame = +3

Query: 87 LGVTSNRISLFFLGGKKVLPVALRQVFDAPKLFSGINYVGCGRLDEGRRL*YKSSLKEVA 266
LG TS+ I+ F G VL F LFSG GCGR+ EG SSL+ +
Sbjct: 115 LGHTSSHIAFFLNGENPVL-------FIGDTLFSG----GCGRIFEGTYQQMYSSLERIK 163

Query: 267 QLATHVGVLSCCLGWSETHFVYA 335
L + ++ C +++ + ++A
Sbjct: 164 SLPKNT-LIYCAHEYTKANILWA 185


>sp|A3PBT3|GLO2_PROM0 Hydroxyacylglutathione hydrolase
OS=Prochlorococcus marinus (strain MIT 9301) GN=gloB
PE=3 SV=2
Length = 246

Score = 31.6 bits (70), Expect = 2.3
Identities = 26/83 (31%), Positives = 40/83 (48%)
Frame = +3

Query: 87 LGVTSNRISLFFLGGKKVLPVALRQVFDAPKLFSGINYVGCGRLDEGRRL*YKSSLKEVA 266
LG TS+ I+ F G VL F LFSG GCGR+ EG SSL+ +
Sbjct: 115 LGHTSSHIAFFLNGENPVL-------FIGDTLFSG----GCGRIFEGTYQQMYSSLERIK 163

Query: 267 QLATHVGVLSCCLGWSETHFVYA 335
L ++ C +++++ ++A
Sbjct: 164 SLPKDT-LIYCAHEYTKSNILWA 185


>sp|Q4K6J3|MURG_PSEF5
UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
pyrophosphoryl-undecaprenol N-acetylglucosamine
transferase OS=Pseudomonas fluorescens (strain Pf-5 /
ATCC BAA-477) GN=murG PE=3 SV=1
Length = 356

Score = 31.2 bits (69), Expect = 3.0
Identities = 30/108 (27%), Positives = 48/108 (44%), Gaps = 7/108 (6%)
Frame = +3

Query: 93 VTSNRISLFFLGGK-------KVLPVALRQVFDAPKLFSGINYVGCGRLDEGRRL*YKSS 251
+ + L LGG K+LP AL QV AP+L + + DE Y+++
Sbjct: 175 LAGRKARLLILGGSLGAEPLNKLLPEALAQV--APELRPEVFHQAGKNHDEVTAERYRAA 232

Query: 252 LKEVAQLATHVGVLSCCLGWSETHFVYAGAAYVVRASARFMPSSCTPI 395
E AQ+ + ++ GW++ AGA V +A +PS P+
Sbjct: 233 GVE-AQVQPFIKDMAQAYGWADLVVCRAGALTVSELAAAGLPSMLVPL 279


>sp|Q1LT01|GLO2_BAUCH Hydroxyacylglutathione hydrolase OS=Baumannia
cicadellinicola subsp. Homalodisca coagulata GN=gloB
PE=3 SV=1
Length = 257

Score = 31.2 bits (69), Expect = 3.0
Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 2/61 (3%)
Frame = +3

Query: 165 FDAPKLFSG--INYVGCGRLDEGRRL*YKSSLKEVAQLATHVGVLSCCLGWSETHFVYAG 338
+ P LF G + GCGR+ EG S +EV QL++H ++ C ++ T+ +A
Sbjct: 117 YSYPWLFCGDTVFSAGCGRIFEGTTKQMYESFQEVNQLSSHT-LICCAHEYTLTNLAFAS 175

Query: 339 A 341
+
Sbjct: 176 S 176


>sp|Q31BX5|GLO2_PROM9 Hydroxyacylglutathione hydrolase
OS=Prochlorococcus marinus (strain MIT 9312) GN=gloB
PE=3 SV=1
Length = 246

Score = 30.4 bits (67), Expect = 5.1
Identities = 25/83 (30%), Positives = 40/83 (48%)
Frame = +3

Query: 87 LGVTSNRISLFFLGGKKVLPVALRQVFDAPKLFSGINYVGCGRLDEGRRL*YKSSLKEVA 266
LG T++ I+ F G VL F LFSG GCGR+ EG SSL+ +
Sbjct: 115 LGHTNSHIAFFVNGESPVL-------FIGDTLFSG----GCGRIFEGTYQQMYSSLERIK 163

Query: 267 QLATHVGVLSCCLGWSETHFVYA 335
L + ++ C +++ + ++A
Sbjct: 164 SLPKNT-LIYCAHEYTKANLLWA 185


>sp|A8GA75|GLO2_SERP5 Hydroxyacylglutathione hydrolase OS=Serratia
proteamaculans (strain 568) GN=gloB PE=3 SV=1
Length = 251

Score = 30.0 bits (66), Expect = 6.7
Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 2/48 (4%)
Frame = +3

Query: 165 FDAPKLFSG--INYVGCGRLDEGRRL*YKSSLKEVAQLATHVGVLSCC 302
+ AP LF G I GCGRL EG +S +++AQL + L CC
Sbjct: 118 YSAPYLFCGDTIFSAGCGRLFEGTAEQMFNSFQQLAQLPDN--TLICC 163


tr_hit_id B7G4U5
Definition tr|B7G4U5|B7G4U5_PHATR G protein beta subunit OS=Phaeodactylum tricornutum CCAP 1055/1
Align length 79
Score (bit) 37.7
E-value 0.34
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944259|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0005_H14, 5'
(517 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B7G4U5|B7G4U5_PHATR G protein beta subunit OS=Phaeodactylum t... 38 0.34
tr|Q7NS75|Q7NS75_CHRVO Dihydroorotate oxidase OS=Chromobacterium... 33 6.4
tr|Q4SHL7|Q4SHL7_TETNG Chromosome 5 SCAF14581, whole genome shot... 33 8.5

>tr|B7G4U5|B7G4U5_PHATR G protein beta subunit OS=Phaeodactylum
tricornutum CCAP 1055/1 GN=PHATRDRAFT_21897 PE=4 SV=1
Length = 351

Score = 37.7 bits (86), Expect = 0.34
Identities = 23/79 (29%), Positives = 38/79 (48%)
Frame = +3

Query: 93 VTSNRISLFFLGGKKVLPVALRQVFDAPKLFSGINYVGCGRLDEGRRL*YKSSLKEVAQL 272
+TSN++ L V+ V + Q N V CG LD + ++++ + A++
Sbjct: 88 ITSNKLQSIGLKSSYVMAVGIEQTRG--------NLVACGGLDNLCTIFPRNNVGKAAEM 139

Query: 273 ATHVGVLSCCLGWSETHFV 329
A+H G LSCC SE +
Sbjct: 140 ASHDGFLSCCRFLSEQEII 158


>tr|Q7NS75|Q7NS75_CHRVO Dihydroorotate oxidase OS=Chromobacterium
violaceum GN=pydA PE=4 SV=1
Length = 316

Score = 33.5 bits (75), Expect = 6.4
Identities = 17/36 (47%), Positives = 21/36 (58%)
Frame = +3

Query: 123 LGGKKVLPVALRQVFDAPKLFSGINYVGCGRLDEGR 230
LGG VLP AL V + +L G + VGCG + GR
Sbjct: 225 LGGDYVLPTALANVREFYRLLPGKDVVGCGGVKSGR 260


>tr|Q4SHL7|Q4SHL7_TETNG Chromosome 5 SCAF14581, whole genome shotgun
sequence. (Fragment) OS=Tetraodon nigroviridis
GN=GSTENG00018094001 PE=4 SV=1
Length = 441

Score = 33.1 bits (74), Expect = 8.5
Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
Frame = +1

Query: 367 DSCHHHVHQ-SCPEGL*PVNYVIITLEHYSTRCCIIQMNIP 486
+SC H++H PE L P + + + STR C+ Q+ +P
Sbjct: 315 ESCVHYIHNVRAPEQLHPCGWTCLLVRVCSTRSCVCQVKVP 355