DK944524
Clone id YMU02A01NGRL0006_F16
Library
Length 352
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0006_F16. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
GATGCGCGTGAGTCGCGCGATGGTAGCTCCTATGCCCTCGCTTCTCTGCTCCACGCGTCT
GCAGTTTCAGATTCGGGGACGGCTTGCATGCTCACCTTCGCCAACCTCTGCCAGGTGCGC
CATGTTCTGCCCATGGTCTTTGATTGCCTTCGGATCTGGCTCATGTTTGCGGGATGGCTT
CTTGTGGAGTTCTCATTTTCGGTTGTGGTCTGAGATGGGATTAAATAGGCGGGTCTTGAG
GTTGGGACTGTTGGGCGTCTTTGAGAGTTGTATATCAGGTATTGTTCTTCTTCTTCAGCA
TGTGTTGGGTATGTAAAAAAAAAGAAAAAAAAAAAAAAAAAAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id Q4WXQ7
Definition sp|Q4WXQ7|NST1_ASPFU Stress response protein nst1 OS=Aspergillus fumigatus
Align length 34
Score (bit) 30.8
E-value 2.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944524|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0006_F16, 5'
(314 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q4WXQ7|NST1_ASPFU Stress response protein nst1 OS=Aspergillus... 31 2.2
sp|A1D731|NST1_NEOFI Stress response protein nst1 OS=Neosartorya... 30 2.9
sp|Q6IQC7|TXD14_DANRE Thioredoxin domain-containing protein 14 O... 30 4.9
sp|Q5XHJ5|RSRC2_XENTR Arginine/serine-rich coiled-coil protein 2... 30 4.9
sp|Q96MG2|JSPR1_HUMAN Junctional sarcoplasmic reticulum protein ... 30 4.9

>sp|Q4WXQ7|NST1_ASPFU Stress response protein nst1 OS=Aspergillus
fumigatus GN=nst1 PE=3 SV=1
Length = 1153

Score = 30.8 bits (68), Expect = 2.2
Identities = 15/34 (44%), Positives = 18/34 (52%)
Frame = +3

Query: 75 GDGLHAHLRQPLPGAPCSAHGL*LPSDLAHVCGM 176
G GLHA L QP P P S G +P + V G+
Sbjct: 768 GQGLHAMLHQPQPSTPLSPLGRSIPPGFSSVNGI 801


>sp|A1D731|NST1_NEOFI Stress response protein nst1 OS=Neosartorya
fischeri (strain ATCC 1020 / DSM 3700 / NRRL 181)
GN=nst1 PE=3 SV=1
Length = 1193

Score = 30.4 bits (67), Expect = 2.9
Identities = 15/34 (44%), Positives = 18/34 (52%)
Frame = +3

Query: 75 GDGLHAHLRQPLPGAPCSAHGL*LPSDLAHVCGM 176
G GLHA L QP P P S G +P + V G+
Sbjct: 769 GHGLHAMLHQPQPSTPLSPLGRSIPPGFSSVNGI 802


>sp|Q6IQC7|TXD14_DANRE Thioredoxin domain-containing protein 14
OS=Danio rerio GN=txndc14 PE=2 SV=1
Length = 307

Score = 29.6 bits (65), Expect = 4.9
Identities = 23/69 (33%), Positives = 36/69 (52%)
Frame = -1

Query: 260 RRPTVPTSRPAYLIPSQTTTENENSTRSHPANMSQIRRQSKTMGRTWRTWQRLAKVSMQA 81
RRP V A S T TE EN R N++++ ++SK +G+T +R +++
Sbjct: 231 RRPQVDKKGRAV---SWTFTE-ENIIREF--NLNELYQKSKKLGKTKEKLERPSELVFST 284

Query: 80 VPESETADA 54
VPE E +A
Sbjct: 285 VPEEEEPEA 293


>sp|Q5XHJ5|RSRC2_XENTR Arginine/serine-rich coiled-coil protein 2
OS=Xenopus tropicalis GN=rsrc2 PE=2 SV=1
Length = 409

Score = 29.6 bits (65), Expect = 4.9
Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 3/61 (4%)
Frame = -3

Query: 213 SDHNRK*ELHKKPSRKHEPDPKAIKDHGQNM---AHLAEVGEGEHASRPRI*NCRRVEQR 43
S R+ E+ +K S+KH PD +DH + + +E GE H RR E+R
Sbjct: 65 SKEARRHEVKEKSSKKHRPDDSIDRDHSDKVRERLNSSENGEERH---------RRKEKR 115

Query: 42 S 40
S
Sbjct: 116 S 116


>sp|Q96MG2|JSPR1_HUMAN Junctional sarcoplasmic reticulum protein 1
OS=Homo sapiens GN=JSRP1 PE=2 SV=1
Length = 331

Score = 29.6 bits (65), Expect = 4.9
Identities = 12/22 (54%), Positives = 14/22 (63%)
Frame = -2

Query: 193 RTPQEAIPQT*ARSEGNQRPWA 128
R P+EA+PQ EG RPWA
Sbjct: 271 REPREALPQRWESREGGHRPWA 292


tr_hit_id Q17JP3
Definition tr|Q17JP3|Q17JP3_AEDAE Putative uncharacterized protein OS=Aedes aegypti
Align length 62
Score (bit) 36.6
E-value 0.64
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944524|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0006_F16, 5'
(314 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q17JP3|Q17JP3_AEDAE Putative uncharacterized protein OS=Aedes... 37 0.64
tr|A7ECT2|A7ECT2_SCLS1 Putative uncharacterized protein OS=Scler... 36 0.84
tr|A9LZZ6|A9LZZ6_NEIM0 tRNA/rRNA methyltransferase OS=Neisseria ... 35 1.4
tr|A1KUH1|A1KUH1_NEIMF SpoU methylase family protein OS=Neisseri... 35 1.4
tr|A1ISE9|A1ISE9_NEIMA SpoU methylase family protein OS=Neisseri... 35 1.4
tr|B8AF50|B8AF50_ORYSI Putative uncharacterized protein OS=Oryza... 35 1.9
tr|B6HVL5|B6HVL5_PENCH Pc22g14960 protein OS=Penicillium chrysog... 35 2.5
tr|Q62J30|Q62J30_BURMA RNA methyltransferase, TrmH family, group... 34 3.2
tr|Q3JQS9|Q3JQS9_BURP1 RNA methyltransferase, TrmH family, group... 34 3.2
tr|A5XYM5|A5XYM5_BURMA RNA methyltransferase, TrmH family, group... 34 3.2
tr|B6HFX9|B6HFX9_PENCH Pc20g10870 protein OS=Penicillium chrysog... 34 3.2
tr|Q63SS2|Q63SS2_BURPS Putative tRNA/rRNA methyltransferase prot... 33 5.5
tr|A3NWY6|A3NWY6_BURP0 RNA methyltransferase, TrmH family, group... 33 5.5
tr|A3NB57|A3NB57_BURP6 RNA methyltransferase, TrmH family, group... 33 5.5
tr|A3ML51|A3ML51_BURM7 RNA methyltransferase, TrmH family, group... 33 5.5
tr|A2SAX2|A2SAX2_BURM9 RNA methyltransferase, TrmH family, group... 33 5.5
tr|A1V5H6|A1V5H6_BURMS RNA methyltransferase, TrmH family, group... 33 5.5
tr|B7CLV2|B7CLV2_BURPS RNA methyltransferase, TrmH family, group... 33 5.5
tr|B2H9V5|B2H9V5_BURPS RNA methyltransferase, TrmH family, group... 33 5.5
tr|B1HKU7|B1HKU7_BURPS RNA methyltransferase, TrmH family, group... 33 5.5
tr|A9K9F0|A9K9F0_BURMA RNA methyltransferase, TrmH family, group... 33 5.5
tr|A8KVV6|A8KVV6_BURPS RNA methyltransferase, TrmH family, group... 33 5.5
tr|A8EC39|A8EC39_BURPS RNA methyltransferase, TrmH family, group... 33 5.5
tr|A5XH74|A5XH74_BURMA RNA methyltransferase, TrmH family, group... 33 5.5
tr|A5TJU0|A5TJU0_BURMA RNA methyltransferase, TrmH family, group... 33 5.5
tr|A4LD65|A4LD65_BURPS RNA methyltransferase, TrmH family, group... 33 5.5
tr|B3DK08|B3DK08_DANRE Cacna1d protein OS=Danio rerio GN=cacna1d... 33 7.1
tr|A4HQ92|A4HQ92_LEIBR Putative uncharacterized protein OS=Leish... 33 7.1
tr|B1XQV8|B1XQV8_SYNP2 Putative uncharacterized protein OS=Synec... 33 9.3
tr|Q9LAA1|Q9LAA1_STASI Amidase-hexosaminidase OS=Staphylococcus ... 33 9.3

>tr|Q17JP3|Q17JP3_AEDAE Putative uncharacterized protein OS=Aedes
aegypti GN=AAEL001932 PE=4 SV=1
Length = 260

Score = 36.6 bits (83), Expect = 0.64
Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 2/62 (3%)
Frame = -1

Query: 245 PTSRPAYLIPSQTTTENENSTRSHPANMSQ--IRRQSKTMGRTWRTWQRLAKVSMQAVPE 72
PTS+ + +PS T ++NS R+ Q SK +GR W T+ RL ++S ++ E
Sbjct: 144 PTSQERFPVPSDPTKSHDNSIRNSFTKHRQAIFSLLSKEIGRNWSTFGRLMQLSDSSLEE 203

Query: 71 SE 66
E
Sbjct: 204 IE 205


>tr|A7ECT2|A7ECT2_SCLS1 Putative uncharacterized protein
OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 /
Ss-1) GN=SS1G_03121 PE=4 SV=1
Length = 779

Score = 36.2 bits (82), Expect = 0.84
Identities = 23/87 (26%), Positives = 43/87 (49%)
Frame = -1

Query: 266 SQRRPTVPTSRPAYLIPSQTTTENENSTRSHPANMSQIRRQSKTMGRTWRTWQRLAKVSM 87
S++R + +S+ S+ TT+ + +H + + +++Q + + TW R + VS
Sbjct: 4 SRKRSKLDSSKEQSTNSSKDTTDQGVTPPNHVQHAAAVKKQLGSRASWYGTWLRKSTVST 63

Query: 86 QAVPESETADAWSREARA*ELPSRDSR 6
Q V E+ +AD S A E+ D R
Sbjct: 64 QVVRETISADKTSNGNMATEINHYDQR 90


>tr|A9LZZ6|A9LZZ6_NEIM0 tRNA/rRNA methyltransferase OS=Neisseria
meningitidis serogroup C (strain 053442) GN=NMCC_1260
PE=4 SV=1
Length = 292

Score = 35.4 bits (80), Expect = 1.4
Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 1/81 (1%)
Frame = -1

Query: 281 YLIYNSQRRPTVPTSRPAYLIPSQTTTENENSTR-SHPANMSQIRRQSKTMGRTWRTWQR 105
Y +++S R+P + T +PA +P+ TR SHPAN+ R KTMG T
Sbjct: 11 YTLFHSDRKPNMTTLKPA--LPAYLDNIRIILTRTSHPANIGSAARAMKTMGLHKLT--- 65

Query: 104 LAKVSMQAVPESETADAWSRE 42
+ ++ A P +E + E
Sbjct: 66 IVAPNLMATPMTENPPVFDPE 86


>tr|A1KUH1|A1KUH1_NEIMF SpoU methylase family protein OS=Neisseria
meningitidis serogroup C / serotype 2a (strain ATCC
700532 / FAM18) GN=NMC1284 PE=4 SV=1
Length = 292

Score = 35.4 bits (80), Expect = 1.4
Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 1/81 (1%)
Frame = -1

Query: 281 YLIYNSQRRPTVPTSRPAYLIPSQTTTENENSTR-SHPANMSQIRRQSKTMGRTWRTWQR 105
Y +++S R+P + T +PA +P+ TR SHPAN+ R KTMG T
Sbjct: 11 YTLFHSDRKPNMTTLKPA--LPAYLDNIRIILTRTSHPANIGSAARAMKTMGLHKLT--- 65

Query: 104 LAKVSMQAVPESETADAWSRE 42
+ ++ A P +E + E
Sbjct: 66 IVAPNLMATPMTENPPVFDPE 86


>tr|A1ISE9|A1ISE9_NEIMA SpoU methylase family protein OS=Neisseria
meningitidis serogroup A GN=NMA1560 PE=4 SV=1
Length = 292

Score = 35.4 bits (80), Expect = 1.4
Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 1/81 (1%)
Frame = -1

Query: 281 YLIYNSQRRPTVPTSRPAYLIPSQTTTENENSTR-SHPANMSQIRRQSKTMGRTWRTWQR 105
Y +++S R+P + T +PA +P+ TR SHPAN+ R KTMG T
Sbjct: 11 YTLFHSDRKPNMTTLKPA--LPAYLDNIRIILTRTSHPANIGSAARAMKTMGLHKLT--- 65

Query: 104 LAKVSMQAVPESETADAWSRE 42
+ ++ A P +E + E
Sbjct: 66 IVAPNLMATPMTENPPVFDPE 86


>tr|B8AF50|B8AF50_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_09506 PE=4 SV=1
Length = 239

Score = 35.0 bits (79), Expect = 1.9
Identities = 22/79 (27%), Positives = 35/79 (44%), Gaps = 2/79 (2%)
Frame = -1

Query: 296 EEEEQYLIYNSQRRPTVPTSRPAYLIPSQTTTENENSTRSHPANMSQIRRQSKTMGRT-- 123
+++ YL +PT P R + P + T++ N HP+++ Q R +G
Sbjct: 107 DKDMDYLAIIEYHKPTKPRVRHSR--PWSSCTKSSNRGNFHPSSILQTRVNLTRLGTPTL 164

Query: 122 WRTWQRLAKVSMQAVPESE 66
WR W+ VSM P E
Sbjct: 165 WRYWKHFNLVSMNPDPSKE 183


>tr|B6HVL5|B6HVL5_PENCH Pc22g14960 protein OS=Penicillium
chrysogenum Wisconsin 54-1255 GN=Pc22g14960 PE=4 SV=1
Length = 1780

Score = 34.7 bits (78), Expect = 2.5
Identities = 28/105 (26%), Positives = 50/105 (47%), Gaps = 6/105 (5%)
Frame = -1

Query: 314 TYPTHAEEEEQYLIYNSQRRPTVPTSRPAY----LIPSQTTTENENSTRSHPANMSQIRR 147
TY +H+E+++ Y+ P++PTS +Y L SQ + ST P + IR
Sbjct: 675 TYSSHSEQQDDLDSYSQYNHPSLPTSAESYGDALLSSSQVPRSSSLSTPIGPRTDAPIRS 734

Query: 146 QSKTMGRTWRTWQR--LAKVSMQAVPESETADAWSREARA*ELPS 18
++ +R Q+ L+++ + +P + A A A +LPS
Sbjct: 735 KTDADRLRYRQQQQELLSQLQQKHLPHIDPAAA--AAAMTLDLPS 777


>tr|Q62J30|Q62J30_BURMA RNA methyltransferase, TrmH family, group 1
OS=Burkholderia mallei GN=BMA1663 PE=3 SV=1
Length = 306

Score = 34.3 bits (77), Expect = 3.2
Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 6/55 (10%)
Frame = -1

Query: 275 IYNSQRRPTVPTSRPAYLIPSQTTTENENSTR------SHPANMSQIRRQSKTMG 129
+ SQ++P+ P S A P++T STR SHP N+ R KTMG
Sbjct: 3 VLESQQKPSAPPSGAATSRPARTARGGFTSTRFVLVEPSHPGNVGAAARALKTMG 57


>tr|Q3JQS9|Q3JQS9_BURP1 RNA methyltransferase, TrmH family, group 1
OS=Burkholderia pseudomallei (strain 1710b) GN=lasT PE=3
SV=1
Length = 346

Score = 34.3 bits (77), Expect = 3.2
Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 6/55 (10%)
Frame = -1

Query: 275 IYNSQRRPTVPTSRPAYLIPSQTTTENENSTR------SHPANMSQIRRQSKTMG 129
+ SQ++P+ P S A P++T STR SHP N+ R KTMG
Sbjct: 35 VLESQQKPSAPPSGAATSRPARTARGGFTSTRFVLVEPSHPGNVGAAARALKTMG 89


>tr|A5XYM5|A5XYM5_BURMA RNA methyltransferase, TrmH family, group 1
OS=Burkholderia mallei JHU GN=BMAJHU_A0068 PE=3 SV=1
Length = 306

Score = 34.3 bits (77), Expect = 3.2
Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 6/55 (10%)
Frame = -1

Query: 275 IYNSQRRPTVPTSRPAYLIPSQTTTENENSTR------SHPANMSQIRRQSKTMG 129
+ SQ++P+ P S A P++T STR SHP N+ R KTMG
Sbjct: 3 VLESQQKPSAPPSGAATSRPARTARGGFTSTRFVLVEPSHPGNVGAAARALKTMG 57