DK944717
Clone id YMU02A01NGRL0006_P19
Library
Length 502
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0006_P19. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
GCAATCTCCAAACACTTACACAGCAACTGGGAGAGAGGTGTTTGGACTTGGATGCTGGAC
AAGGTCTTATTTCACCATCTCTGGATTAGAGATCTACAGTTCAAAAAATGGTATGATTGA
CAACAGCAGTCCATCTTTCGGAATGTGAAGCAAGGACCCTTGAATTGTGGTATAGAACCT
ACGTGGGAAGTTACTACCTATGGAATTGGGGTGTGTAGGGGCAGTACTCTTGGAACAAAA
GAGAGAAGATCTGTAACAAATGTGAGAGGGTCAGACTGCCGTGATTTGGAGGAAGGACAC
AATTTATTTATTGCAACTTCTCGAATCAAATTCACTTGAGTGATGACAAAAGAAACACAT
TGGAGAGTCCCTTTTGATCAACTTGATCTGTATTGATTTGTGGTCAGAACTTTGCTAAAT
GAATTCTTCCATGTTTTTCCCTCTGATAAAAAAAAAAAAAAAAAAAAAAAAACAAAAAAA
AAAAAAAAAAAAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id Q9VQ89
Definition sp|Q9VQ89|MIO_DROME WD repeat-containing protein mio OS=Drosophila melanogaster
Align length 58
Score (bit) 32.7
E-value 0.71
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944717|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0006_P19, 5'
(447 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9VQ89|MIO_DROME WD repeat-containing protein mio OS=Drosophi... 33 0.71
sp|Q9MAQ3|UBP11_ARATH Putative ubiquitin carboxyl-terminal hydro... 32 0.95
sp|Q07349|YD027_YEAST Uncharacterized protein YDL027C OS=Sacchar... 32 1.6
sp|Q02084|A33_PLEWA Zinc-binding protein A33 OS=Pleurodeles walt... 31 2.1
sp|Q2QNF7|DAPF_ORYSJ Putative diaminopimelate epimerase, chlorop... 31 2.8
sp|A2ZLS4|DAPF_ORYSI Putative diaminopimelate epimerase, chlorop... 31 2.8
sp|Q8IWR0|Z3H7A_HUMAN Zinc finger CCCH domain-containing protein... 30 4.7
sp|O52194|ALGX_AZOVI Alginate biosynthesis protein algX OS=Azoto... 30 6.1
sp|Q0V8T9|CTP5A_MOUSE Contactin associated protein like 5-1 OS=M... 29 7.8

>sp|Q9VQ89|MIO_DROME WD repeat-containing protein mio OS=Drosophila
melanogaster GN=mio PE=2 SV=2
Length = 867

Score = 32.7 bits (73), Expect = 0.71
Identities = 18/58 (31%), Positives = 30/58 (51%)
Frame = +3

Query: 147 EARTLELWYRTYVGSYYLWNWGV*GQYSWNKREKICNKCERVRLP*FGGRTQFIYCNF 320
E + ++ W +Y+ +L +WG+ W KR ++ K E +R RT F+ CNF
Sbjct: 693 EDKRIQYWIASYLD--HLNSWGL-----WEKRAELDIKIESIRPSSRSSRTVFLSCNF 743


>sp|Q9MAQ3|UBP11_ARATH Putative ubiquitin carboxyl-terminal
hydrolase 11 OS=Arabidopsis thaliana GN=UBP11 PE=3 SV=2
Length = 892

Score = 32.3 bits (72), Expect = 0.95
Identities = 16/40 (40%), Positives = 23/40 (57%)
Frame = +1

Query: 205 IGVCRGSTLGTKERRSVTNVRGSDCRDLEEGHNLFIATSR 324
IGVC S +ERR VT + DL+EG+ F+ ++R
Sbjct: 10 IGVCESSYTPEEERRIVTELNNEAEADLKEGNLYFVISNR 49


>sp|Q07349|YD027_YEAST Uncharacterized protein YDL027C
OS=Saccharomyces cerevisiae GN=YDL027C PE=1 SV=1
Length = 420

Score = 31.6 bits (70), Expect = 1.6
Identities = 13/33 (39%), Positives = 21/33 (63%)
Frame = -2

Query: 209 PIP*VVTSHVGSIPQFKGPCFTFRKMDCCCQSY 111
P+P +TS +IP+++G F FRK+ C +Y
Sbjct: 44 PVPSAITSP--AIPKYRGESFQFRKLSCISSNY 74


>sp|Q02084|A33_PLEWA Zinc-binding protein A33 OS=Pleurodeles waltlii
PE=1 SV=2
Length = 625

Score = 31.2 bits (69), Expect = 2.1
Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 3/49 (6%)
Frame = -2

Query: 290 SKSRQSDPLTFVTDLLSFVPRVLPLH---TPIP*VVTSHVGSIPQFKGP 153
S+ +SDP+ F+TD+ SF+ + H P V+ + S +FKGP
Sbjct: 381 SRLNESDPIAFLTDIKSFIEKCCEEHRKGVPAESVLVNKELSQGRFKGP 429


>sp|Q2QNF7|DAPF_ORYSJ Putative diaminopimelate epimerase,
chloroplastic OS=Oryza sativa subsp. japonica GN=DAPF
PE=3 SV=1
Length = 354

Score = 30.8 bits (68), Expect = 2.8
Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 2/59 (3%)
Frame = +1

Query: 181 TWEVTTYGIGVCRGSTLGTKERR--SVTNVRGSDCRDLEEGHNLFIATSRIKFT*VMTK 351
TW+VT +G T GTKE + V +++ SD E H +F A + +F V+++
Sbjct: 221 TWQVTCVSMGNPHCVTFGTKELKVLHVDDLKLSDIGPKFEHHEMFPARTNTEFVEVLSR 279


>sp|A2ZLS4|DAPF_ORYSI Putative diaminopimelate epimerase,
chloroplastic OS=Oryza sativa subsp. indica GN=DAPF PE=3
SV=1
Length = 357

Score = 30.8 bits (68), Expect = 2.8
Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 2/59 (3%)
Frame = +1

Query: 181 TWEVTTYGIGVCRGSTLGTKERR--SVTNVRGSDCRDLEEGHNLFIATSRIKFT*VMTK 351
TW+VT +G T GTKE + V +++ SD E H +F A + +F V+++
Sbjct: 224 TWQVTCVSMGNPHCVTFGTKELKVLHVDDLKLSDIGPKFEHHEMFPARTNTEFVEVLSR 282


>sp|Q8IWR0|Z3H7A_HUMAN Zinc finger CCCH domain-containing protein 7A
OS=Homo sapiens GN=ZC3H7A PE=1 SV=1
Length = 971

Score = 30.0 bits (66), Expect = 4.7
Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
Frame = +1

Query: 19 HSNWERGVWTWM-----LDKVLFHHLWIRDLQFKKWYD*QQQSIFRNVKQ 153
HS ER VWT+M D F+ LW++ + +K D QS N KQ
Sbjct: 794 HSPEEREVWTYMKENGIQDMEQFYELWLKSQKNEKSEDIASQSNKENGKQ 843


>sp|O52194|ALGX_AZOVI Alginate biosynthesis protein algX
OS=Azotobacter vinelandii GN=algX PE=3 SV=1
Length = 483

Score = 29.6 bits (65), Expect = 6.1
Identities = 13/34 (38%), Positives = 18/34 (52%)
Frame = -1

Query: 255 YRSSLFCSKSTAPTHPNSIGSNFPRRFYTTIQGS 154
YR+ C A PNS SN+ + F T +QG+
Sbjct: 37 YRAESCCDLCPAAADPNSYTSNYMKGFVTLVQGN 70


>sp|Q0V8T9|CTP5A_MOUSE Contactin associated protein like 5-1 OS=Mus
musculus GN=Cntnap5a PE=2 SV=1
Length = 1304

Score = 29.3 bits (64), Expect = 7.8
Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
Frame = -2

Query: 131 DCCCQSYHFLNCRSLIQRW*NKT-LSSIQVQTPLSQLL 21
+ C S HF NC + I W N T L S + P++Q++
Sbjct: 726 ESCLDSRHFCNCDADIDEWANDTGLFSFKDHLPVTQII 763


tr_hit_id B4JR08
Definition tr|B4JR08|B4JR08_DROGR GH13084 OS=Drosophila grimshawi
Align length 56
Score (bit) 33.9
E-value 4.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944717|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0006_P19, 5'
(447 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4JR08|B4JR08_DROGR GH13084 OS=Drosophila grimshawi GN=GH1308... 34 4.1
tr|A1CQC8|A1CQC8_ASPCL Mitochondrial inner membrane translocase ... 33 7.2
tr|B2GG53|B2GG53_KOCRD Phosphate transport system permease prote... 33 9.1
tr|Q29MJ3|Q29MJ3_DROPS GA20081 OS=Drosophila pseudoobscura pseud... 33 9.1
tr|B4Q7P3|B4Q7P3_DROSI GD23137 OS=Drosophila simulans GN=GD23137... 33 9.1
tr|B4I2G4|B4I2G4_DROSE GM18321 OS=Drosophila sechellia GN=GM1832... 33 9.1
tr|B4G955|B4G955_DROPE GL18708 OS=Drosophila persimilis GN=GL187... 33 9.1
tr|Q7QKK0|Q7QKK0_ANOGA AGAP003281-PA (Fragment) OS=Anopheles gam... 33 9.4
tr|Q4WTB9|Q4WTB9_ASPFU Mitochondrial inner membrane translocase ... 33 9.4
tr|B0XQA7|B0XQA7_ASPFC Mitochondrial inner membrane translocase ... 33 9.4
tr|A1D392|A1D392_NEOFI Mitochondrial inner membrane translocase ... 33 9.4

>tr|B4JR08|B4JR08_DROGR GH13084 OS=Drosophila grimshawi GN=GH13084
PE=4 SV=1
Length = 883

Score = 33.9 bits (76), Expect = 4.1
Identities = 18/56 (32%), Positives = 29/56 (51%)
Frame = +3

Query: 153 RTLELWYRTYVGSYYLWNWGV*GQYSWNKREKICNKCERVRLP*FGGRTQFIYCNF 320
+ ++ W +Y+ YL +WG+ W KR ++ K E +R RT F+ CNF
Sbjct: 705 KRIQYWIASYLD--YLNSWGL-----WEKRAELDIKIENIRPSARSSRTVFLSCNF 753


>tr|A1CQC8|A1CQC8_ASPCL Mitochondrial inner membrane translocase
subunit TIM44, putative OS=Aspergillus clavatus
GN=ACLA_025660 PE=4 SV=1
Length = 512

Score = 33.1 bits (74), Expect = 7.2
Identities = 14/33 (42%), Positives = 21/33 (63%)
Frame = +1

Query: 121 QQQSIFRNVKQGPLNCGIEPTWEVTTYGIGVCR 219
Q+ ++RNVK G L G+E ++ TY IG+ R
Sbjct: 454 QEVHVYRNVKSGELAAGMEDKVQLVTYAIGLTR 486


>tr|B2GG53|B2GG53_KOCRD Phosphate transport system permease protein
OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC
12708 / DC2201) GN=pstC PE=4 SV=1
Length = 315

Score = 32.7 bits (73), Expect = 9.1
Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 10/75 (13%)
Frame = -2

Query: 347 VITQVNLIREVAINKLCPSSKSRQSDPLTFVTDLLSFVPRVL----------PLHTPIP* 198
+ T V ++ + I+ P+ SR P+ +V DLL+ +P V+ P P+
Sbjct: 89 IATPVGILVALYISHYAPARVSR---PVGYVIDLLAAIPSVIFGAWGATVLAPALVPLYT 145

Query: 197 VVTSHVGSIPQFKGP 153
++ H+G IP F GP
Sbjct: 146 WLSEHLGFIPFFGGP 160


>tr|Q29MJ3|Q29MJ3_DROPS GA20081 OS=Drosophila pseudoobscura
pseudoobscura GN=GA20081 PE=4 SV=1
Length = 870

Score = 32.7 bits (73), Expect = 9.1
Identities = 17/56 (30%), Positives = 29/56 (51%)
Frame = +3

Query: 153 RTLELWYRTYVGSYYLWNWGV*GQYSWNKREKICNKCERVRLP*FGGRTQFIYCNF 320
+ ++ W +Y+ YL +WG+ W KR ++ K E +R RT ++ CNF
Sbjct: 698 KRIQYWISSYLD--YLNSWGL-----WEKRAELDIKIEGIRASARSSRTVYLSCNF 746


>tr|B4Q7P3|B4Q7P3_DROSI GD23137 OS=Drosophila simulans GN=GD23137
PE=4 SV=1
Length = 867

Score = 32.7 bits (73), Expect = 9.1
Identities = 18/58 (31%), Positives = 30/58 (51%)
Frame = +3

Query: 147 EARTLELWYRTYVGSYYLWNWGV*GQYSWNKREKICNKCERVRLP*FGGRTQFIYCNF 320
E + ++ W +Y+ +L +WG+ W KR ++ K E +R RT F+ CNF
Sbjct: 693 EDKRIQYWIASYLD--HLNSWGL-----WEKRAELDIKIESIRPSSRSSRTVFLSCNF 743


>tr|B4I2G4|B4I2G4_DROSE GM18321 OS=Drosophila sechellia GN=GM18321
PE=4 SV=1
Length = 867

Score = 32.7 bits (73), Expect = 9.1
Identities = 18/58 (31%), Positives = 30/58 (51%)
Frame = +3

Query: 147 EARTLELWYRTYVGSYYLWNWGV*GQYSWNKREKICNKCERVRLP*FGGRTQFIYCNF 320
E + ++ W +Y+ +L +WG+ W KR ++ K E +R RT F+ CNF
Sbjct: 693 EDKRIQYWIASYLD--HLNSWGL-----WEKRAELDIKIESIRPSSRSSRTVFLSCNF 743


>tr|B4G955|B4G955_DROPE GL18708 OS=Drosophila persimilis GN=GL18708
PE=4 SV=1
Length = 870

Score = 32.7 bits (73), Expect = 9.1
Identities = 17/56 (30%), Positives = 29/56 (51%)
Frame = +3

Query: 153 RTLELWYRTYVGSYYLWNWGV*GQYSWNKREKICNKCERVRLP*FGGRTQFIYCNF 320
+ ++ W +Y+ YL +WG+ W KR ++ K E +R RT ++ CNF
Sbjct: 698 KRIQYWISSYLD--YLNSWGL-----WEKRAELDIKIEGIRASARSSRTVYLSCNF 746


>tr|Q7QKK0|Q7QKK0_ANOGA AGAP003281-PA (Fragment) OS=Anopheles
gambiae GN=AGAP003281 PE=4 SV=4
Length = 437

Score = 32.7 bits (73), Expect = 9.4
Identities = 12/18 (66%), Positives = 12/18 (66%)
Frame = -1

Query: 366 SPMCFFCHHSSEFDSRSC 313
SP FFCHH FD RSC
Sbjct: 125 SPSLFFCHHRKGFDGRSC 142


>tr|Q4WTB9|Q4WTB9_ASPFU Mitochondrial inner membrane translocase
subunit TIM44, putative OS=Aspergillus fumigatus
GN=AFUA_1G09840 PE=4 SV=1
Length = 523

Score = 32.7 bits (73), Expect = 9.4
Identities = 14/33 (42%), Positives = 21/33 (63%)
Frame = +1

Query: 121 QQQSIFRNVKQGPLNCGIEPTWEVTTYGIGVCR 219
Q+ ++RNVK G L G+E ++ TY IG+ R
Sbjct: 465 QEVHVYRNVKTGELAAGMEDKVQLVTYAIGLTR 497


>tr|B0XQA7|B0XQA7_ASPFC Mitochondrial inner membrane translocase
subunit TIM44, putative OS=Aspergillus fumigatus (strain
CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_009290 PE=4
SV=1
Length = 523

Score = 32.7 bits (73), Expect = 9.4
Identities = 14/33 (42%), Positives = 21/33 (63%)
Frame = +1

Query: 121 QQQSIFRNVKQGPLNCGIEPTWEVTTYGIGVCR 219
Q+ ++RNVK G L G+E ++ TY IG+ R
Sbjct: 465 QEVHVYRNVKTGELAAGMEDKVQLVTYAIGLTR 497