DK944923
Clone id YMU02A01NGRL0007_J19
Library
Length 352
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0007_J19. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID -
Sequence
TAAGTTCTTCTACATCAAAGACAGTACCCATATACCAAATGTGTTACATTTTGAGTATGA
AAACTGTAGAGCTGCTCGGACGTTGGTAGAATCAAAGATGATGCCAAAGCCTTCAATGGA
CTGAATTTGATATGATATTACTGGATTATTGAATTGGTTAAAGCCATTCTTAAACTGATG
GTCACTCTATTTGTGATTTATTGCAACTCTTGAGGATGCGATTGTATGATGTTTTATATT
GGCGATAATTTGTTTGGCAGTTGATCNAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAGCGAAAAAAAAAAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id Q86IX2
Definition sp|Q86IX2|DOPP1_DICDI Dolichyldiphosphatase 1 OS=Dictyostelium discoideum
Align length 21
Score (bit) 31.2
E-value 1.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944923|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0007_J19, 5'
(267 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q86IX2|DOPP1_DICDI Dolichyldiphosphatase 1 OS=Dictyostelium d... 31 1.7
sp|B2KI79|DOPP1_RHIFE Dolichyldiphosphatase 1 OS=Rhinolophus fer... 31 2.2
sp|B0CM95|DOPP1_PAPAN Dolichyldiphosphatase 1 OS=Papio anubis GN... 31 2.2
sp|Q9JMF7|DOPP1_MOUSE Dolichyldiphosphatase 1 OS=Mus musculus GN... 31 2.2
sp|Q86YN1|DOPP1_HUMAN Dolichyldiphosphatase 1 OS=Homo sapiens GN... 31 2.2
sp|B1MTH4|DOPP1_CALMO Dolichyldiphosphatase 1 OS=Callicebus molo... 31 2.2
sp|B0KWE9|DOPP1_CALJA Dolichyldiphosphatase 1 OS=Callithrix jacc... 31 2.2
sp|Q9N0Z6|AT1A1_RABIT Sodium/potassium-transporting ATPase subun... 30 3.8
sp|P06685|AT1A1_RAT Sodium/potassium-transporting ATPase subunit... 30 4.9
sp|Q5RDR3|AT1A1_PONAB Sodium/potassium-transporting ATPase subun... 30 4.9
sp|P05023|AT1A1_HUMAN Sodium/potassium-transporting ATPase subun... 30 4.9
sp|P18907|AT1A1_HORSE Sodium/potassium-transporting ATPase subun... 30 4.9
sp|Q54RP7|Y0652_DICDI Probable serine/threonine-protein kinase D... 29 6.4
sp|P04074|AT1A1_SHEEP Sodium/potassium-transporting ATPase subun... 29 6.4
sp|Q8VDN2|AT1A1_MOUSE Sodium/potassium-transporting ATPase subun... 29 6.4
sp|Q08DA1|AT1A1_BOVIN Sodium/potassium-transporting ATPase subun... 29 6.4
sp|Q92123|AT1A1_XENLA Sodium/potassium-transporting ATPase subun... 29 8.4
sp|P05024|AT1A1_PIG Sodium/potassium-transporting ATPase subunit... 29 8.4

>sp|Q86IX2|DOPP1_DICDI Dolichyldiphosphatase 1 OS=Dictyostelium
discoideum GN=dolpp1 PE=3 SV=1
Length = 229

Score = 31.2 bits (69), Expect = 1.7
Identities = 11/21 (52%), Positives = 18/21 (85%)
Frame = +2

Query: 2 KFFYIKDSTHIPNVLHFEYEN 64
K+FY++DS+ I ++L+FEY N
Sbjct: 192 KYFYLRDSSEIEDLLNFEYTN 212


>sp|B2KI79|DOPP1_RHIFE Dolichyldiphosphatase 1 OS=Rhinolophus
ferrumequinum GN=DOLPP1 PE=3 SV=1
Length = 238

Score = 30.8 bits (68), Expect = 2.2
Identities = 14/24 (58%), Positives = 18/24 (75%)
Frame = +2

Query: 2 KFFYIKDSTHIPNVLHFEYENCRA 73
+FF I+D++ IPNVL FEY RA
Sbjct: 201 EFFLIRDTSLIPNVLWFEYTVTRA 224


>sp|B0CM95|DOPP1_PAPAN Dolichyldiphosphatase 1 OS=Papio anubis
GN=DOLPP1 PE=3 SV=1
Length = 238

Score = 30.8 bits (68), Expect = 2.2
Identities = 14/24 (58%), Positives = 18/24 (75%)
Frame = +2

Query: 2 KFFYIKDSTHIPNVLHFEYENCRA 73
+FF I+D++ IPNVL FEY RA
Sbjct: 201 EFFLIRDTSLIPNVLWFEYTVTRA 224


>sp|Q9JMF7|DOPP1_MOUSE Dolichyldiphosphatase 1 OS=Mus musculus
GN=Dolpp1 PE=2 SV=1
Length = 238

Score = 30.8 bits (68), Expect = 2.2
Identities = 14/24 (58%), Positives = 18/24 (75%)
Frame = +2

Query: 2 KFFYIKDSTHIPNVLHFEYENCRA 73
+FF I+D++ IPNVL FEY RA
Sbjct: 201 EFFLIRDTSLIPNVLWFEYTVTRA 224


>sp|Q86YN1|DOPP1_HUMAN Dolichyldiphosphatase 1 OS=Homo sapiens
GN=DOLPP1 PE=1 SV=1
Length = 238

Score = 30.8 bits (68), Expect = 2.2
Identities = 14/24 (58%), Positives = 18/24 (75%)
Frame = +2

Query: 2 KFFYIKDSTHIPNVLHFEYENCRA 73
+FF I+D++ IPNVL FEY RA
Sbjct: 201 EFFLIRDTSLIPNVLWFEYTVTRA 224


>sp|B1MTH4|DOPP1_CALMO Dolichyldiphosphatase 1 OS=Callicebus moloch
GN=DOLPP1 PE=3 SV=1
Length = 238

Score = 30.8 bits (68), Expect = 2.2
Identities = 14/24 (58%), Positives = 18/24 (75%)
Frame = +2

Query: 2 KFFYIKDSTHIPNVLHFEYENCRA 73
+FF I+D++ IPNVL FEY RA
Sbjct: 201 EFFLIRDTSLIPNVLWFEYTVTRA 224


>sp|B0KWE9|DOPP1_CALJA Dolichyldiphosphatase 1 OS=Callithrix jacchus
GN=DOLPP1 PE=3 SV=1
Length = 238

Score = 30.8 bits (68), Expect = 2.2
Identities = 14/24 (58%), Positives = 18/24 (75%)
Frame = +2

Query: 2 KFFYIKDSTHIPNVLHFEYENCRA 73
+FF I+D++ IPNVL FEY RA
Sbjct: 201 EFFLIRDTSLIPNVLWFEYTVTRA 224


>sp|Q9N0Z6|AT1A1_RABIT Sodium/potassium-transporting ATPase subunit
alpha-1 OS=Oryctolagus cuniculus GN=ATP1A1 PE=2 SV=2
Length = 1023

Score = 30.0 bits (66), Expect = 3.8
Identities = 17/54 (31%), Positives = 29/54 (53%)
Frame = -1

Query: 183 DHQFKNGFNQFNNPVISYQIQSIEGFGIIFDSTNVRAALQFSYSKCNTFGIWVL 22
D QF GF QF+ +++ + ++ G+I RAA+ + KC + GI V+
Sbjct: 562 DEQFPEGF-QFDTDEVNFPVDNLCFIGLISMIDPPRAAVPDAVGKCRSAGIKVI 614


>sp|P06685|AT1A1_RAT Sodium/potassium-transporting ATPase subunit
alpha-1 OS=Rattus norvegicus GN=Atp1a1 PE=1 SV=1
Length = 1023

Score = 29.6 bits (65), Expect = 4.9
Identities = 17/54 (31%), Positives = 29/54 (53%)
Frame = -1

Query: 183 DHQFKNGFNQFNNPVISYQIQSIEGFGIIFDSTNVRAALQFSYSKCNTFGIWVL 22
D QF GF QF+ +++ + ++ G+I RAA+ + KC + GI V+
Sbjct: 562 DEQFPEGF-QFDTDEVNFPVDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVI 614


>sp|Q5RDR3|AT1A1_PONAB Sodium/potassium-transporting ATPase subunit
alpha-1 OS=Pongo abelii GN=ATP1A1 PE=2 SV=1
Length = 1023

Score = 29.6 bits (65), Expect = 4.9
Identities = 18/54 (33%), Positives = 29/54 (53%)
Frame = -1

Query: 183 DHQFKNGFNQFNNPVISYQIQSIEGFGIIFDSTNVRAALQFSYSKCNTFGIWVL 22
D QF GF QF+ +++ I ++ G+I RAA+ + KC + GI V+
Sbjct: 562 DEQFPEGF-QFDTDDVNFPIDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVI 614


tr_hit_id Q9LYX7
Definition tr|Q9LYX7|Q9LYX7_ARATH Putative uncharacterized protein F15A17_110 OS=Arabidopsis thaliana
Align length 31
Score (bit) 42.7
E-value 0.009
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944923|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0007_J19, 5'
(267 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9LYX7|Q9LYX7_ARATH Putative uncharacterized protein F15A17_1... 43 0.009
tr|Q6NLA5|Q6NLA5_ARATH At5g03080 (Putative uncharacterized prote... 43 0.009
tr|B6UB05|B6UB05_MAIZE Dolichyldiphosphatase 1 OS=Zea mays PE=2 ... 43 0.009
tr|A2XFF1|A2XFF1_ORYSI Putative uncharacterized protein OS=Oryza... 43 0.009
tr|A7PT01|A7PT01_VITVI Chromosome chr8 scaffold_29, whole genome... 42 0.012
tr|A5BHE7|A5BHE7_VITVI Putative uncharacterized protein OS=Vitis... 42 0.012
tr|Q10MZ3|Q10MZ3_ORYSJ Os03g0288700 protein OS=Oryza sativa subs... 42 0.020
tr|A9NK99|A9NK99_PICSI Putative uncharacterized protein OS=Picea... 39 0.098
tr|A9TLK8|A9TLK8_PHYPA Predicted protein OS=Physcomitrella paten... 39 0.13
tr|A9RL46|A9RL46_PHYPA Predicted protein OS=Physcomitrella paten... 36 0.83
tr|A0YDY1|A0YDY1_9GAMM TonB-dependent receptor OS=marine gamma p... 33 5.4

>tr|Q9LYX7|Q9LYX7_ARATH Putative uncharacterized protein F15A17_110
OS=Arabidopsis thaliana GN=F15A17_110 PE=4 SV=1
Length = 268

Score = 42.7 bits (99), Expect = 0.009
Identities = 17/31 (54%), Positives = 26/31 (83%)
Frame = +2

Query: 2 KFFYIKDSTHIPNVLHFEYENCRAARTLVES 94
++ Y+KD++HIP+VL FEY+N RAAR ++S
Sbjct: 192 RWLYVKDTSHIPDVLKFEYDNARAARKDMDS 222


>tr|Q6NLA5|Q6NLA5_ARATH At5g03080 (Putative uncharacterized protein
At5g03080) OS=Arabidopsis thaliana GN=At5g03080 PE=2
SV=1
Length = 226

Score = 42.7 bits (99), Expect = 0.009
Identities = 17/31 (54%), Positives = 26/31 (83%)
Frame = +2

Query: 2 KFFYIKDSTHIPNVLHFEYENCRAARTLVES 94
++ Y+KD++HIP+VL FEY+N RAAR ++S
Sbjct: 192 RWLYVKDTSHIPDVLKFEYDNARAARKDMDS 222


>tr|B6UB05|B6UB05_MAIZE Dolichyldiphosphatase 1 OS=Zea mays PE=2
SV=1
Length = 227

Score = 42.7 bits (99), Expect = 0.009
Identities = 18/29 (62%), Positives = 24/29 (82%)
Frame = +2

Query: 2 KFFYIKDSTHIPNVLHFEYENCRAARTLV 88
++ YIKD++HIP+VL FEY+N RAAR V
Sbjct: 196 RWLYIKDTSHIPDVLKFEYDNARAARKKV 224


>tr|A2XFF1|A2XFF1_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_11094 PE=4 SV=1
Length = 224

Score = 42.7 bits (99), Expect = 0.009
Identities = 18/29 (62%), Positives = 24/29 (82%)
Frame = +2

Query: 2 KFFYIKDSTHIPNVLHFEYENCRAARTLV 88
++ YIKD++HIP+VL FEY+N RAAR V
Sbjct: 193 RWLYIKDTSHIPDVLKFEYDNARAARRKV 221


>tr|A7PT01|A7PT01_VITVI Chromosome chr8 scaffold_29, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00023155001
PE=4 SV=1
Length = 222

Score = 42.4 bits (98), Expect = 0.012
Identities = 18/26 (69%), Positives = 22/26 (84%)
Frame = +2

Query: 2 KFFYIKDSTHIPNVLHFEYENCRAAR 79
++FYIKD++HI NVL FEYE RAAR
Sbjct: 189 RWFYIKDTSHIHNVLEFEYEKARAAR 214


>tr|A5BHE7|A5BHE7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_012122 PE=4 SV=1
Length = 225

Score = 42.4 bits (98), Expect = 0.012
Identities = 18/26 (69%), Positives = 22/26 (84%)
Frame = +2

Query: 2 KFFYIKDSTHIPNVLHFEYENCRAAR 79
++FYIKD++HI NVL FEYE RAAR
Sbjct: 192 RWFYIKDTSHIHNVLEFEYEKARAAR 217


>tr|Q10MZ3|Q10MZ3_ORYSJ Os03g0288700 protein OS=Oryza sativa subsp.
japonica GN=Os03g0288700 PE=2 SV=1
Length = 224

Score = 41.6 bits (96), Expect = 0.020
Identities = 17/29 (58%), Positives = 24/29 (82%)
Frame = +2

Query: 2 KFFYIKDSTHIPNVLHFEYENCRAARTLV 88
++ Y+KD++HIP+VL FEY+N RAAR V
Sbjct: 193 RWLYMKDTSHIPDVLKFEYDNARAARRKV 221


>tr|A9NK99|A9NK99_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 226

Score = 39.3 bits (90), Expect = 0.098
Identities = 16/26 (61%), Positives = 21/26 (80%)
Frame = +2

Query: 2 KFFYIKDSTHIPNVLHFEYENCRAAR 79
++ IKDS+HIP+ L FEY+N RAAR
Sbjct: 186 EYLCIKDSSHIPDALRFEYQNARAAR 211


>tr|A9TLK8|A9TLK8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_147431 PE=4 SV=1
Length = 241

Score = 38.9 bits (89), Expect = 0.13
Identities = 17/40 (42%), Positives = 26/40 (65%)
Frame = +2

Query: 2 KFFYIKDSTHIPNVLHFEYENCRAARTLVESKMMPKPSMD 121
++ IKDS+HIP+V+ FEY N R AR +++ K S +
Sbjct: 197 QYLRIKDSSHIPDVIGFEYRNSRVARRNLQNNATSKSSSE 236


>tr|A9RL46|A9RL46_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_104795 PE=4 SV=1
Length = 241

Score = 36.2 bits (82), Expect = 0.83
Identities = 15/26 (57%), Positives = 20/26 (76%)
Frame = +2

Query: 2 KFFYIKDSTHIPNVLHFEYENCRAAR 79
++ IKDS+HIP+V+ FEY N R AR
Sbjct: 197 RYLRIKDSSHIPDVIGFEYRNSRDAR 222