DK944924
Clone id YMU02A01NGRL0007_J20
Library
Length 439
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0007_J20. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID
Sequence
GGGATTTGGGCTTATTGTGCCTAGAAACAATGAGTCTTGGGAGAAATTGGATAACGGGGC
CACAAAGAAGAGCTAGGTTGCAAGTTACAGTGGCTCTCTGATTGCTCGTGTGGAATGCAG
GAAGAGAGAATATGGTTGGGCATGGCTTGTGTATCTCAACCAGGAAGAGTACTGTATATA
ACTTGGTAATCGCTGTATGGTTTCCTTGACACAGCTGTGAAAGCTTTGTACTCATGGTGG
CTCTATGTTAGGTGGCCGCCATATTGAAAGTGATTCGGCCAGTTCCCCTATACCCTATGC
GATGTAGGAGGTCACTTTGAGCTTGGTTACTGCGGTTGACTTTTGAAGGAGGTCAGCCTT
GACCCACCCTTAGTTTTGGCTAATGCTCAACATAATCTTTCTCCTCGACGAANAAAAAAA
AAAAAAAAAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id P75242
Definition sp|P75242|RUVB_MYCPN Holliday junction ATP-dependent DNA helicase ruvB OS=Mycoplasma pneumoniae
Align length 84
Score (bit) 33.9
E-value 0.26
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944924|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0007_J20, 5'
(410 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P75242|RUVB_MYCPN Holliday junction ATP-dependent DNA helicas... 34 0.26
sp|P01882|IGHDM_MOUSE Ig delta chain C region membrane-bound for... 31 1.7
sp|Q8BRH4|MLL3_MOUSE Histone-lysine N-methyltransferase MLL3 OS=... 29 8.5

>sp|P75242|RUVB_MYCPN Holliday junction ATP-dependent DNA helicase
ruvB OS=Mycoplasma pneumoniae GN=ruvB PE=3 SV=1
Length = 307

Score = 33.9 bits (76), Expect = 0.26
Identities = 27/84 (32%), Positives = 39/84 (46%), Gaps = 10/84 (11%)
Frame = -2

Query: 343 KVNRSNQAQSDLLHRIGYRGTGRITFNMAAT*HRATMSTKLSQLCQGNH----------T 194
K +R N+AQ D + G G G+ T + M+TKL Q+ QG H
Sbjct: 29 KASRINKAQLDHILLYGPPGVGKTTLARLIA---SEMNTKL-QIIQGGHLQRPSDFLNAV 84

Query: 193 AITKLYTVLFLVEIHKPCPTIFSL 122
++ K VLF+ EIH P++ L
Sbjct: 85 SLIKKGDVLFVDEIHAVAPSVMEL 108


>sp|P01882|IGHDM_MOUSE Ig delta chain C region membrane-bound form
OS=Mus musculus PE=2 SV=3
Length = 290

Score = 31.2 bits (69), Expect = 1.7
Identities = 13/27 (48%), Positives = 18/27 (66%)
Frame = -1

Query: 137 NHILSSCIPHEQSESHCNLQPSSSLWP 57
N I SCI EQS+S+ +L+ + LWP
Sbjct: 239 NTIQHSCIMDEQSDSYMDLEEENGLWP 265


>sp|Q8BRH4|MLL3_MOUSE Histone-lysine N-methyltransferase MLL3 OS=Mus
musculus GN=Mll3 PE=2 SV=2
Length = 4903

Score = 28.9 bits (63), Expect = 8.5
Identities = 14/34 (41%), Positives = 22/34 (64%)
Frame = -1

Query: 131 ILSSCIPHEQSESHCNLQPSSSLWPRYPISPKTH 30
+LSS + +E+ + +++PS S P PISP TH
Sbjct: 2912 VLSSLLSNEKCDDS-DIRPSGSSPPSLPISPSTH 2944


tr_hit_id A9TA00
Definition tr|A9TA00|A9TA00_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 22
Score (bit) 34.3
E-value 3.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK944924|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0007_J20, 5'
(410 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TA00|A9TA00_PHYPA Predicted protein OS=Physcomitrella paten... 34 3.2
tr|B2W7B6|B2W7B6_PYRTR Putative uncharacterized protein OS=Pyren... 33 5.5
tr|A9SGI5|A9SGI5_PHYPA Predicted protein OS=Physcomitrella paten... 33 9.3
tr|A9RWK9|A9RWK9_PHYPA Predicted protein OS=Physcomitrella paten... 33 9.3
tr|A0C7A8|A0C7A8_PARTE Chromosome undetermined scaffold_154, who... 33 9.3

>tr|A9TA00|A9TA00_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_220250 PE=4 SV=1
Length = 297

Score = 34.3 bits (77), Expect = 3.2
Identities = 15/22 (68%), Positives = 19/22 (86%)
Frame = +2

Query: 2 GFGLIVPRNNESWEKLDNGATK 67
G+G+IVPRN+ESWE NGA+K
Sbjct: 275 GYGIIVPRNDESWE-AGNGASK 295


>tr|B2W7B6|B2W7B6_PYRTR Putative uncharacterized protein
OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP)
GN=PTRG_05704 PE=4 SV=1
Length = 1709

Score = 33.5 bits (75), Expect = 5.5
Identities = 22/60 (36%), Positives = 28/60 (46%), Gaps = 3/60 (5%)
Frame = -1

Query: 206 RKPYSD---YQVIYSTLPG*DTQAMPNHILSSCIPHEQSESHCNLQPSSSLWPRYPISPK 36
R P SD + ST P P++I++ P Q ES P SS WPR P+ PK
Sbjct: 1136 RSPSSDATSLNTLSSTKPQPPKPRKPSNIVNQPSPLAQQES-APRNPGSSTWPRPPVGPK 1194


>tr|A9SGI5|A9SGI5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_129502 PE=4 SV=1
Length = 498

Score = 32.7 bits (73), Expect = 9.3
Identities = 15/35 (42%), Positives = 19/35 (54%)
Frame = -2

Query: 220 SQLCQGNHTAITKLYTVLFLVEIHKPCPTIFSLPA 116
+Q C GNHTA LY++ F P T F +PA
Sbjct: 350 AQFCGGNHTAFLTLYSLTFFFANFGPNVTTFIIPA 384


>tr|A9RWK9|A9RWK9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_120515 PE=4 SV=1
Length = 221

Score = 32.7 bits (73), Expect = 9.3
Identities = 14/24 (58%), Positives = 18/24 (75%)
Frame = +2

Query: 2 GFGLIVPRNNESWEKLDNGATKKS 73
G+G+IVPRN E+WE NG +K S
Sbjct: 199 GYGIIVPRNEEAWE-AGNGVSKSS 221


>tr|A0C7A8|A0C7A8_PARTE Chromosome undetermined scaffold_154, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00035805001 PE=4 SV=1
Length = 3063

Score = 32.7 bits (73), Expect = 9.3
Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%)
Frame = +1

Query: 61 HKEELGCKLQWLSDC-SCGMQEERIWLGMACVSQPG 165
H L CK ++ SDC SC Q++R G C+ QPG
Sbjct: 894 HYSCLSCKGRFSSDCISCWDQDKRTLSGTTCICQPG 929