DK945424
Clone id YMU02A01NGRL0009_E09
Library
Length 543
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0009_E09. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID
Sequence
GTGTCATGAGGCCAGAGTTGGTGATGAAGTCAATTGTTCCAGTTGTCATGGCTGGTGTCC
TGGGTATCTATGGCTTGATTATAGCCGTGATCATCAGTACAGGCATCAACCCCACAAGTA
CAGCCTATTATCTTTTTGATGGATATGCGCACCTGTCTTCAGGCCTTGCTTGTGGTTTAG
CAGGTCTTTCTGCAGGAATGGCCATTGGTATCGTTGGTGACGCAGGCGTAAGGGCAAATG
CACAGCAACCGAAACTATTTGTGGGCATGATACTTATTTTGATTTTTGCAGAGGCACTTG
CTCTGTACGGTCTTATCGTGGGAATCATCCTCTCCTCACGTACTGGTCAATCTAGGGAGT
AATTTATAGCGTATGTCTTGTGCTCACCCTTCACTAGCGAGCCTGTTGTGCTGTGCAAGT
AGTAATGCTCTCTTGAGCATGCCATGATGACTGTTACGGATATAGAATGTTTTGGAGGTT
GTGGGAAGCAGCTGCTGCACCAGCAGATTTTGTTGAATAAGTCGAGGAGAATATGTCGAT
TCT
■■Homology search results ■■ -
sp_hit_id Q40585
Definition sp|Q40585|VATL_TOBAC V-type proton ATPase 16 kDa proteolipid subunit OS=Nicotiana tabacum
Align length 118
Score (bit) 153.0
E-value 6.0e-37
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK945424|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0009_E09, 5'
(543 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q40585|VATL_TOBAC V-type proton ATPase 16 kDa proteolipid sub... 153 6e-37
sp|O24011|VATL_SOLLC V-type proton ATPase 16 kDa proteolipid sub... 153 6e-37
sp|O22552|VATL_PHAAU V-type proton ATPase 16 kDa proteolipid sub... 153 6e-37
sp|P68161|VATL_MESCR V-type proton ATPase 16 kDa proteolipid sub... 153 6e-37
sp|Q96473|VATL_KALDA V-type proton ATPase 16 kDa proteolipid sub... 153 6e-37
sp|Q43434|VATL_GOSHI V-type proton ATPase 16 kDa proteolipid sub... 153 6e-37
sp|P68162|VATL_BETVU V-type proton ATPase 16 kDa proteolipid sub... 153 6e-37
sp|P59229|VATL4_ARATH V-type proton ATPase 16 kDa proteolipid su... 153 6e-37
sp|P59228|VATL2_ARATH V-type proton ATPase 16 kDa proteolipid su... 153 6e-37
sp|P59227|VATL1_ARATH V-type proton ATPase 16 kDa proteolipid su... 153 6e-37
sp|Q0IUB5|VATL_ORYSJ V-type proton ATPase 16 kDa proteolipid sub... 152 1e-36
sp|A2ZBW5|VATL_ORYSI V-type proton ATPase 16 kDa proteolipid sub... 152 1e-36
sp|P23957|VATL_AVESA V-type proton ATPase 16 kDa proteolipid sub... 150 3e-36
sp|Q41773|VATL_MAIZE V-type proton ATPase 16 kDa proteolipid sub... 132 1e-30
sp|Q43362|VATL_PLECA V-type proton ATPase 16 kDa proteolipid sub... 105 1e-22
sp|P55277|VATL_HELVI V-type proton ATPase 16 kDa proteolipid sub... 103 5e-22
sp|P31403|VATL_MANSE V-type proton ATPase 16 kDa proteolipid sub... 103 7e-22
sp|O16110|VATL_AEDAE V-type proton ATPase 16 kDa proteolipid sub... 102 2e-21
sp|Q17046|VATL_ASCSU V-type proton ATPase 16 kDa proteolipid sub... 100 4e-21
sp|P34546|VATL2_CAEEL V-type proton ATPase 16 kDa proteolipid su... 100 4e-21
sp|Q612A5|VATL2_CAEBR V-type proton ATPase 16 kDa proteolipid su... 100 4e-21
sp|Q26250|VATL_NEPNO V-type proton ATPase 16 kDa proteolipid sub... 99 1e-20
sp|P31413|VATL_NEUCR V-type proton ATPase 16 kDa proteolipid sub... 99 2e-20
sp|P23380|VATL_DROME V-type proton ATPase 16 kDa proteolipid sub... 99 2e-20
sp|Q03105|VATL_TORMA V-type proton ATPase 16 kDa proteolipid sub... 98 3e-20
sp|O18882|VATL_SHEEP V-type proton ATPase 16 kDa proteolipid sub... 97 4e-20
sp|P63081|VATL_RAT V-type proton ATPase 16 kDa proteolipid subun... 97 4e-20
sp|P63082|VATL_MOUSE V-type proton ATPase 16 kDa proteolipid sub... 97 4e-20
sp|P23956|VATL_BOVIN V-type proton ATPase 16 kDa proteolipid sub... 97 4e-20
sp|P27449|VATL_HUMAN V-type proton ATPase 16 kDa proteolipid sub... 97 7e-20

>sp|Q40585|VATL_TOBAC V-type proton ATPase 16 kDa proteolipid
subunit OS=Nicotiana tabacum PE=2 SV=1
Length = 165

Score = 153 bits (386), Expect = 6e-37
Identities = 84/118 (71%), Positives = 86/118 (72%)
Frame = +3

Query: 3 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPTSTAYYLFDGYXXXXXXXXXXXX 182
VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP + +YYLFDGY
Sbjct: 46 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHLSSGLACGLA 105

Query: 183 XXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRTGQSR 356
MAIGIVGDAGVRANAQQPKLFVGM YGLIVGIILSSR GQSR
Sbjct: 106 GLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSR 163


>sp|O24011|VATL_SOLLC V-type proton ATPase 16 kDa proteolipid
subunit OS=Solanum lycopersicum PE=2 SV=1
Length = 164

Score = 153 bits (386), Expect = 6e-37
Identities = 84/118 (71%), Positives = 86/118 (72%)
Frame = +3

Query: 3 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPTSTAYYLFDGYXXXXXXXXXXXX 182
VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP + +YYLFDGY
Sbjct: 45 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKTKSYYLFDGYAHLSSGLACGLA 104

Query: 183 XXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRTGQSR 356
MAIGIVGDAGVRANAQQPKLFVGM YGLIVGIILSSR GQSR
Sbjct: 105 GLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSR 162


>sp|O22552|VATL_PHAAU V-type proton ATPase 16 kDa proteolipid
subunit OS=Phaseolus aureus PE=2 SV=1
Length = 164

Score = 153 bits (386), Expect = 6e-37
Identities = 84/118 (71%), Positives = 86/118 (72%)
Frame = +3

Query: 3 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPTSTAYYLFDGYXXXXXXXXXXXX 182
VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP + +YYLFDGY
Sbjct: 45 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLA 104

Query: 183 XXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRTGQSR 356
MAIGIVGDAGVRANAQQPKLFVGM YGLIVGIILSSR GQSR
Sbjct: 105 GLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSR 162


>sp|P68161|VATL_MESCR V-type proton ATPase 16 kDa proteolipid
subunit OS=Mesembryanthemum crystallinum GN=VMAC1 PE=2
SV=1
Length = 165

Score = 153 bits (386), Expect = 6e-37
Identities = 84/118 (71%), Positives = 86/118 (72%)
Frame = +3

Query: 3 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPTSTAYYLFDGYXXXXXXXXXXXX 182
VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP + +YYLFDGY
Sbjct: 46 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLA 105

Query: 183 XXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRTGQSR 356
MAIGIVGDAGVRANAQQPKLFVGM YGLIVGIILSSR GQSR
Sbjct: 106 GLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSR 163


>sp|Q96473|VATL_KALDA V-type proton ATPase 16 kDa proteolipid
subunit OS=Kalanchoe daigremontiana PE=2 SV=1
Length = 165

Score = 153 bits (386), Expect = 6e-37
Identities = 84/118 (71%), Positives = 86/118 (72%)
Frame = +3

Query: 3 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPTSTAYYLFDGYXXXXXXXXXXXX 182
VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP + +YYLFDGY
Sbjct: 46 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLA 105

Query: 183 XXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRTGQSR 356
MAIGIVGDAGVRANAQQPKLFVGM YGLIVGIILSSR GQSR
Sbjct: 106 GLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSR 163


>sp|Q43434|VATL_GOSHI V-type proton ATPase 16 kDa proteolipid
subunit OS=Gossypium hirsutum GN=CVA16-2 PE=2 SV=1
Length = 165

Score = 153 bits (386), Expect = 6e-37
Identities = 84/118 (71%), Positives = 86/118 (72%)
Frame = +3

Query: 3 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPTSTAYYLFDGYXXXXXXXXXXXX 182
VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP + +YYLFDGY
Sbjct: 46 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLA 105

Query: 183 XXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRTGQSR 356
MAIGIVGDAGVRANAQQPKLFVGM YGLIVGIILSSR GQSR
Sbjct: 106 GLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSR 163


>sp|P68162|VATL_BETVU V-type proton ATPase 16 kDa proteolipid
subunit OS=Beta vulgaris GN=VMAC1 PE=2 SV=1
Length = 165

Score = 153 bits (386), Expect = 6e-37
Identities = 84/118 (71%), Positives = 86/118 (72%)
Frame = +3

Query: 3 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPTSTAYYLFDGYXXXXXXXXXXXX 182
VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP + +YYLFDGY
Sbjct: 46 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLA 105

Query: 183 XXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRTGQSR 356
MAIGIVGDAGVRANAQQPKLFVGM YGLIVGIILSSR GQSR
Sbjct: 106 GLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSR 163


>sp|P59229|VATL4_ARATH V-type proton ATPase 16 kDa proteolipid
subunit 4 OS=Arabidopsis thaliana GN=AVAP4 PE=2 SV=1
Length = 166

Score = 153 bits (386), Expect = 6e-37
Identities = 84/118 (71%), Positives = 86/118 (72%)
Frame = +3

Query: 3 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPTSTAYYLFDGYXXXXXXXXXXXX 182
VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP + +YYLFDGY
Sbjct: 47 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLA 106

Query: 183 XXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRTGQSR 356
MAIGIVGDAGVRANAQQPKLFVGM YGLIVGIILSSR GQSR
Sbjct: 107 GLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSR 164


>sp|P59228|VATL2_ARATH V-type proton ATPase 16 kDa proteolipid
subunit 2 OS=Arabidopsis thaliana GN=AVAP2 PE=2 SV=1
Length = 165

Score = 153 bits (386), Expect = 6e-37
Identities = 84/118 (71%), Positives = 86/118 (72%)
Frame = +3

Query: 3 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPTSTAYYLFDGYXXXXXXXXXXXX 182
VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP + +YYLFDGY
Sbjct: 46 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLA 105

Query: 183 XXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRTGQSR 356
MAIGIVGDAGVRANAQQPKLFVGM YGLIVGIILSSR GQSR
Sbjct: 106 GLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSR 163


>sp|P59227|VATL1_ARATH V-type proton ATPase 16 kDa proteolipid
subunit 1/3/5 OS=Arabidopsis thaliana GN=AVAP1 PE=2 SV=1
Length = 164

Score = 153 bits (386), Expect = 6e-37
Identities = 84/118 (71%), Positives = 86/118 (72%)
Frame = +3

Query: 3 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPTSTAYYLFDGYXXXXXXXXXXXX 182
VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP + +YYLFDGY
Sbjct: 45 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLA 104

Query: 183 XXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRTGQSR 356
MAIGIVGDAGVRANAQQPKLFVGM YGLIVGIILSSR GQSR
Sbjct: 105 GLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSR 162


tr_hit_id A9S3D7
Definition tr|A9S3D7|A9S3D7_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 118
Score (bit) 154.0
E-value 3.0e-36
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK945424|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0009_E09, 5'
(543 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9S3D7|A9S3D7_PHYPA Predicted protein OS=Physcomitrella paten... 154 3e-36
tr|Q676Z0|Q676Z0_HYAOR Vacuolar H+-ATPase proteolipid 16 kDa sub... 153 5e-36
tr|Q9ZQS2|Q9ZQS2_CITUN Vacuolar H+-ATPase c subunit OS=Citrus un... 153 6e-36
tr|Q9SXS6|Q9SXS6_CITUN Vacuolar H+-ATPase c subunit OS=Citrus un... 153 6e-36
tr|Q9SE27|Q9SE27_DENCR Vacuolar H+-ATP synthase 16kDa proteolipi... 153 6e-36
tr|Q9SBK0|Q9SBK0_PHAAU Adenosine triphosphatase (Fragment) OS=Ph... 153 6e-36
tr|Q9AXF4|Q9AXF4_AVIMR Vacuolar ATPase subunit c OS=Avicennia ma... 153 6e-36
tr|Q84MJ9|Q84MJ9_SUASA Vacuolar H(+)-ATPase subunit c OS=Suaeda ... 153 6e-36
tr|Q76MT7|Q76MT7_CITUN Vacuolar H+-ATPase c subunit OS=Citrus un... 153 6e-36
tr|Q712V5|Q712V5_BETVU Subunit c of V-type ATPase OS=Beta vulgar... 153 6e-36
tr|Q6IDA4|Q6IDA4_ARATH At2g16510 (AT4g34720/T4L20_300) OS=Arabid... 153 6e-36
tr|Q5ZFS1|Q5ZFS1_PLAMJ Vacuolar H+-ATPase C subunit (Vacuolar H+... 153 6e-36
tr|Q3HVP1|Q3HVP1_SOLTU Vacuolar proton ATPase proteolipid subuni... 153 6e-36
tr|Q24JM2|Q24JM2_ARATH At1g19910 OS=Arabidopsis thaliana PE=2 SV=1 153 6e-36
tr|B3TLT5|B3TLT5_ELAGV Vacuolar H+-ATP synthase 16kDa proteolipi... 153 6e-36
tr|A9PHB1|A9PHB1_POPTR Putative uncharacterized protein OS=Popul... 153 6e-36
tr|A9PBF9|A9PBF9_POPTR Putative uncharacterized protein OS=Popul... 153 6e-36
tr|A9PAK2|A9PAK2_POPTR Putative uncharacterized protein OS=Popul... 153 6e-36
tr|A9P9J2|A9P9J2_POPTR Putative uncharacterized protein OS=Popul... 153 6e-36
tr|A9NL02|A9NL02_PICSI Putative uncharacterized protein OS=Picea... 153 6e-36
tr|A5C5A3|A5C5A3_VITVI Putative uncharacterized protein (Chromos... 153 6e-36
tr|A5ANS5|A5ANS5_VITVI Putative uncharacterized protein (Chromos... 153 6e-36
tr|A0A075|A0A075_ACAEB H+-ATPase proteolipid OS=Acanthus ebracte... 153 6e-36
tr|B7FMP1|B7FMP1_MEDTR Putative uncharacterized protein OS=Medic... 152 8e-36
tr|B7FHD6|B7FHD6_MEDTR Putative uncharacterized protein OS=Medic... 152 8e-36
tr|Q94G11|Q94G11_ORYCO V-ATPase subunit c OS=Oryza coarctata GN=... 152 1e-35
tr|Q945E8|Q945E8_PENAM Vacuolar H+-ATPase 16 kDa proteolipid sub... 152 1e-35
tr|Q0IPT8|Q0IPT8_ORYSJ Os12g0168900 protein OS=Oryza sativa subs... 152 1e-35
tr|B7EXI1|B7EXI1_ORYSJ cDNA clone:001-038-H05, full insert seque... 152 1e-35
tr|B6SK76|B6SK76_MAIZE Putative uncharacterized protein OS=Zea m... 152 1e-35

>tr|A9S3D7|A9S3D7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_180835 PE=3 SV=1
Length = 167

Score = 154 bits (389), Expect = 3e-36
Identities = 85/118 (72%), Positives = 86/118 (72%)
Frame = +3

Query: 3 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPTSTAYYLFDGYXXXXXXXXXXXX 182
VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP S AYY+FDGY
Sbjct: 48 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKSKAYYVFDGYAHLSSGLSCGLA 107

Query: 183 XXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRTGQSR 356
MAIGIVGDAGVRANAQQPKLFVGM YGLIVGIILSSR GQSR
Sbjct: 108 GLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSR 165


>tr|Q676Z0|Q676Z0_HYAOR Vacuolar H+-ATPase proteolipid 16 kDa
subunit (Fragment) OS=Hyacinthus orientalis PE=2 SV=1
Length = 158

Score = 153 bits (387), Expect = 5e-36
Identities = 84/118 (71%), Positives = 86/118 (72%)
Frame = +3

Query: 3 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPTSTAYYLFDGYXXXXXXXXXXXX 182
VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP + +YYLFDGY
Sbjct: 39 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPNAKSYYLFDGYAHLSSGLACGLA 98

Query: 183 XXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRTGQSR 356
MAIGIVGDAGVRANAQQPKLFVGM YGLIVGIILSSR GQSR
Sbjct: 99 GLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSR 156


>tr|Q9ZQS2|Q9ZQS2_CITUN Vacuolar H+-ATPase c subunit OS=Citrus
unshiu GN=CitVATP c-3 PE=2 SV=1
Length = 166

Score = 153 bits (386), Expect = 6e-36
Identities = 84/118 (71%), Positives = 86/118 (72%)
Frame = +3

Query: 3 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPTSTAYYLFDGYXXXXXXXXXXXX 182
VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP + +YYLFDGY
Sbjct: 47 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLA 106

Query: 183 XXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRTGQSR 356
MAIGIVGDAGVRANAQQPKLFVGM YGLIVGIILSSR GQSR
Sbjct: 107 GLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSR 164


>tr|Q9SXS6|Q9SXS6_CITUN Vacuolar H+-ATPase c subunit OS=Citrus
unshiu GN=CitVATP c-1 PE=2 SV=1
Length = 165

Score = 153 bits (386), Expect = 6e-36
Identities = 84/118 (71%), Positives = 86/118 (72%)
Frame = +3

Query: 3 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPTSTAYYLFDGYXXXXXXXXXXXX 182
VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP + +YYLFDGY
Sbjct: 46 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLA 105

Query: 183 XXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRTGQSR 356
MAIGIVGDAGVRANAQQPKLFVGM YGLIVGIILSSR GQSR
Sbjct: 106 GLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSR 163


>tr|Q9SE27|Q9SE27_DENCR Vacuolar H+-ATP synthase 16kDa proteolipid
subunit OS=Dendrobium crumenatum PE=2 SV=1
Length = 164

Score = 153 bits (386), Expect = 6e-36
Identities = 84/118 (71%), Positives = 86/118 (72%)
Frame = +3

Query: 3 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPTSTAYYLFDGYXXXXXXXXXXXX 182
VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP + +YYLFDGY
Sbjct: 45 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLA 104

Query: 183 XXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRTGQSR 356
MAIGIVGDAGVRANAQQPKLFVGM YGLIVGIILSSR GQSR
Sbjct: 105 GLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSR 162


>tr|Q9SBK0|Q9SBK0_PHAAU Adenosine triphosphatase (Fragment)
OS=Phaseolus aureus PE=2 SV=1
Length = 145

Score = 153 bits (386), Expect = 6e-36
Identities = 84/118 (71%), Positives = 86/118 (72%)
Frame = +3

Query: 3 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPTSTAYYLFDGYXXXXXXXXXXXX 182
VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP + +YYLFDGY
Sbjct: 26 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLA 85

Query: 183 XXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRTGQSR 356
MAIGIVGDAGVRANAQQPKLFVGM YGLIVGIILSSR GQSR
Sbjct: 86 GLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSR 143


>tr|Q9AXF4|Q9AXF4_AVIMR Vacuolar ATPase subunit c OS=Avicennia
marina PE=2 SV=1
Length = 165

Score = 153 bits (386), Expect = 6e-36
Identities = 84/118 (71%), Positives = 86/118 (72%)
Frame = +3

Query: 3 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPTSTAYYLFDGYXXXXXXXXXXXX 182
VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP + +YYLFDGY
Sbjct: 46 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLA 105

Query: 183 XXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRTGQSR 356
MAIGIVGDAGVRANAQQPKLFVGM YGLIVGIILSSR GQSR
Sbjct: 106 GLAAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSR 163


>tr|Q84MJ9|Q84MJ9_SUASA Vacuolar H(+)-ATPase subunit c OS=Suaeda
salsa PE=2 SV=1
Length = 164

Score = 153 bits (386), Expect = 6e-36
Identities = 84/118 (71%), Positives = 86/118 (72%)
Frame = +3

Query: 3 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPTSTAYYLFDGYXXXXXXXXXXXX 182
VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP + +YYLFDGY
Sbjct: 45 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLA 104

Query: 183 XXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRTGQSR 356
MAIGIVGDAGVRANAQQPKLFVGM YGLIVGIILSSR GQSR
Sbjct: 105 GLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSR 162


>tr|Q76MT7|Q76MT7_CITUN Vacuolar H+-ATPase c subunit OS=Citrus
unshiu GN=Cit-VATP c-2 PE=2 SV=1
Length = 165

Score = 153 bits (386), Expect = 6e-36
Identities = 84/118 (71%), Positives = 86/118 (72%)
Frame = +3

Query: 3 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPTSTAYYLFDGYXXXXXXXXXXXX 182
VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP + +YYLFDGY
Sbjct: 46 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLA 105

Query: 183 XXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRTGQSR 356
MAIGIVGDAGVRANAQQPKLFVGM YGLIVGIILSSR GQSR
Sbjct: 106 GLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSR 163


>tr|Q712V5|Q712V5_BETVU Subunit c of V-type ATPase OS=Beta vulgaris
PE=2 SV=1
Length = 165

Score = 153 bits (386), Expect = 6e-36
Identities = 84/118 (71%), Positives = 86/118 (72%)
Frame = +3

Query: 3 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPTSTAYYLFDGYXXXXXXXXXXXX 182
VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINP + +YYLFDGY
Sbjct: 46 VMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLA 105

Query: 183 XXXXXMAIGIVGDAGVRANAQQPKLFVGMXXXXXXXXXXXXYGLIVGIILSSRTGQSR 356
MAIGIVGDAGVRANAQQPKLFVGM YGLIVGIILSSR GQSR
Sbjct: 106 GLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSR 163