DK945442
Clone id YMU02A01NGRL0009_F09
Library
Length 570
Definition Adiantum capillus-veneris psaB mRNA for photosystem I P700 apoprotein A2, chloroplastic, partial cds
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID
Sequence
GATGCTAGCCTTCGGGACTCCGGAAAAACAGATTCTTATTGAACCCGTATTTGCTCAGTG
GATTCAATCTGCTCATGGTAAAGTTTCATACGGTTTTGACGTGCTTCTATCTTCAGTAGA
TAGTCCGGCAAGTAATGTTGGTCGGGGCTTGTGGTTACCTGGCTGGTTAGACGCTGTTAA
CAGTAGCAATAATTCGTTATTTTTAACGATTGGTCCCGGGGATTTTCTCGTTCACCACGC
CATTGCTTTAGGTTTACACACCACTACACTAATTTTGGTGAAAGGTGCTTTAGATGCACG
CGGGTCCAAGTTGATGCCGGATAAGAAAGAATTTGGTTATAGTTTTCCTTGCGATGGCCC
CGGCCGAGGGGGAACTTGCGACATTTCTGCCTGGGATGCTTTCTACTTAGCTGTCTTTTG
GATGCTGAACACAATTGGATGGGTTACCTTCTATTGGCACTGGAAACACATCACTTTATG
GCAGGGCAATGCTGCTCAATTCAACGAATCTTCTACGTATCTAATGGGATGGCTAAGAGA
TTATTTATGGCTAAATTCCTCGCAGCTTAT
■■Homology search results ■■ -
sp_hit_id Q85FM0
Definition sp|Q85FM0|PSAB_ADICA Photosystem I P700 chlorophyll a apoprotein A2 OS=Adiantum capillus-veneris
Align length 189
Score (bit) 403.0
E-value 1.0e-112
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK945442|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0009_F09, 5'
(570 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q85FM0|PSAB_ADICA Photosystem I P700 chlorophyll a apoprotein... 403 e-112
sp|Q8MFA2|PSAB_PHYPA Photosystem I P700 chlorophyll a apoprotein... 385 e-106
sp|Q85AV8|PSAB_ANTFO Photosystem I P700 chlorophyll a apoprotein... 384 e-106
sp|P06408|PSAB_MARPO Photosystem I P700 chlorophyll a apoprotein... 383 e-106
sp|Q09G47|PSAB_PLAOC Photosystem I P700 chlorophyll a apoprotein... 382 e-106
sp|Q2PMU2|PSAB_SOYBN Photosystem I P700 chlorophyll a apoprotein... 382 e-106
sp|A4GYQ9|PSAB_POPTR Photosystem I P700 chlorophyll a apoprotein... 382 e-106
sp|Q14FF8|PSAB_POPAL Photosystem I P700 chlorophyll a apoprotein... 382 e-106
sp|Q3BAP1|PSAB_PHAAO Photosystem I P700 chlorophyll a apoprotein... 382 e-106
sp|Q9MTN7|PSAB_OENEH Photosystem I P700 chlorophyll a apoprotein... 382 e-106
sp|P58385|PSAB_LOTJA Photosystem I P700 chlorophyll a apoprotein... 382 e-106
sp|A4GG98|PSAB_PHAVU Photosystem I P700 chlorophyll a apoprotein... 381 e-105
sp|P58765|PSAB_PSINU Photosystem I P700 chlorophyll a apoprotein... 381 e-105
sp|A4QKJ1|PSAB_CAPBU Photosystem I P700 chlorophyll a apoprotein... 381 e-105
sp|Q68S07|PSAB_PANGI Photosystem I P700 chlorophyll a apoprotein... 380 e-105
sp|Q09FW2|PSAB_NANDO Photosystem I P700 chlorophyll a apoprotein... 380 e-105
sp|Q2L903|PSAB_GOSHI Photosystem I P700 chlorophyll a apoprotein... 380 e-105
sp|A0ZZ34|PSAB_GOSBA Photosystem I P700 chlorophyll a apoprotein... 380 e-105
sp|Q06GZ8|PSAB_DRIGR Photosystem I P700 chlorophyll a apoprotein... 380 e-105
sp|Q0G9W3|PSAB_DAUCA Photosystem I P700 chlorophyll a apoprotein... 380 e-105
sp|A6MMC1|PSAB_CHLSC Photosystem I P700 chlorophyll a apoprotein... 380 e-105
sp|Q7YJX3|PSAB_CALFG Photosystem I P700 chlorophyll a apoprotein... 380 e-105
sp|P06407|PSAB_TOBAC Photosystem I P700 chlorophyll a apoprotein... 380 e-105
sp|P06512|PSAB_SPIOL Photosystem I P700 chlorophyll a apoprotein... 380 e-105
sp|Q33C37|PSAB_NICTO Photosystem I P700 chlorophyll a apoprotein... 380 e-105
sp|Q3C1H9|PSAB_NICSY Photosystem I P700 chlorophyll a apoprotein... 380 e-105
sp|Q09X18|PSAB_MORIN Photosystem I P700 chlorophyll a apoprotein... 380 e-105
sp|Q0G9M0|PSAB_LIRTU Photosystem I P700 chlorophyll a apoprotein... 380 e-105
sp|A6MMK6|PSAB_DIOEL Photosystem I P700 chlorophyll a apoprotein... 380 e-105
sp|Q4VZN4|PSAB_CUCSA Photosystem I P700 chlorophyll a apoprotein... 380 e-105

>sp|Q85FM0|PSAB_ADICA Photosystem I P700 chlorophyll a apoprotein A2
OS=Adiantum capillus-veneris GN=psaB PE=2 SV=2
Length = 734

Score = 403 bits (1036), Expect = e-112
Identities = 188/189 (99%), Positives = 188/189 (99%)
Frame = +2

Query: 2 MLAFGTPEKQILIEPVFAQWIQSAHGKVSYGFDVLLSSVDSPASNVGRGLWLPGWLDAVN 181
MLAFGTPEKQILIEPVFAQWIQSAHGKVSYGFDVLLSSVDSPASN GRGLWLPGWLDAVN
Sbjct: 443 MLAFGTPEKQILIEPVFAQWIQSAHGKVSYGFDVLLSSVDSPASNAGRGLWLPGWLDAVN 502

Query: 182 SSNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 361
SSNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP
Sbjct: 503 SSNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 562

Query: 362 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD 541
GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD
Sbjct: 563 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD 622

Query: 542 YLWLNSSQL 568
YLWLNSSQL
Sbjct: 623 YLWLNSSQL 631


>sp|Q8MFA2|PSAB_PHYPA Photosystem I P700 chlorophyll a apoprotein A2
OS=Physcomitrella patens GN=psaB PE=3 SV=1
Length = 734

Score = 385 bits (988), Expect = e-106
Identities = 177/189 (93%), Positives = 182/189 (96%)
Frame = +2

Query: 2 MLAFGTPEKQILIEPVFAQWIQSAHGKVSYGFDVLLSSVDSPASNVGRGLWLPGWLDAVN 181
MLAFGTPEKQILIEPVFAQWIQSAHGK YGFDVLLSS DSPA N G+ LWLPGWLDA+N
Sbjct: 443 MLAFGTPEKQILIEPVFAQWIQSAHGKALYGFDVLLSSADSPAFNAGQTLWLPGWLDAIN 502

Query: 182 SSNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 361
+++NSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP
Sbjct: 503 NNSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 562

Query: 362 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD 541
GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGN AQFNESSTYLMGWLRD
Sbjct: 563 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVAQFNESSTYLMGWLRD 622

Query: 542 YLWLNSSQL 568
YLWLNSSQL
Sbjct: 623 YLWLNSSQL 631


>sp|Q85AV8|PSAB_ANTFO Photosystem I P700 chlorophyll a apoprotein A2
OS=Anthoceros formosae GN=psaB PE=2 SV=1
Length = 734

Score = 384 bits (985), Expect = e-106
Identities = 175/189 (92%), Positives = 182/189 (96%)
Frame = +2

Query: 2 MLAFGTPEKQILIEPVFAQWIQSAHGKVSYGFDVLLSSVDSPASNVGRGLWLPGWLDAVN 181
MLAFGTPEKQILIEPVFAQWIQSAHGK YGFD+LLSS DSPA N G+ +WLPGWLDA+N
Sbjct: 443 MLAFGTPEKQILIEPVFAQWIQSAHGKTLYGFDLLLSSADSPAFNAGQSIWLPGWLDAIN 502

Query: 182 SSNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 361
+++NSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP
Sbjct: 503 NNSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 562

Query: 362 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD 541
GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGN AQFNESSTYLMGWLRD
Sbjct: 563 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVAQFNESSTYLMGWLRD 622

Query: 542 YLWLNSSQL 568
YLWLNSSQL
Sbjct: 623 YLWLNSSQL 631


>sp|P06408|PSAB_MARPO Photosystem I P700 chlorophyll a apoprotein A2
OS=Marchantia polymorpha GN=psaB PE=3 SV=1
Length = 734

Score = 383 bits (983), Expect = e-106
Identities = 174/189 (92%), Positives = 183/189 (96%)
Frame = +2

Query: 2 MLAFGTPEKQILIEPVFAQWIQSAHGKVSYGFDVLLSSVDSPASNVGRGLWLPGWLDAVN 181
MLAFGTPEKQILIEP+FAQWIQSAHGK YGFDVLLSS ++PA N G+ +WLPGWLDA+N
Sbjct: 443 MLAFGTPEKQILIEPIFAQWIQSAHGKALYGFDVLLSSTNNPAFNAGQSIWLPGWLDAIN 502

Query: 182 SSNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 361
+++NSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP
Sbjct: 503 NNSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 562

Query: 362 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD 541
GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD
Sbjct: 563 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD 622

Query: 542 YLWLNSSQL 568
YLWLNSSQL
Sbjct: 623 YLWLNSSQL 631


>sp|Q09G47|PSAB_PLAOC Photosystem I P700 chlorophyll a apoprotein A2
OS=Platanus occidentalis GN=psaB PE=3 SV=1
Length = 734

Score = 382 bits (981), Expect = e-106
Identities = 174/189 (92%), Positives = 182/189 (96%)
Frame = +2

Query: 2 MLAFGTPEKQILIEPVFAQWIQSAHGKVSYGFDVLLSSVDSPASNVGRGLWLPGWLDAVN 181
MLAFGTPEKQILIEP+FAQWIQSAHGK SYGFDVLLSS +SPA N GR +WLPGWL+AVN
Sbjct: 443 MLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTNSPAFNAGRSIWLPGWLNAVN 502

Query: 182 SSNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 361
++NSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKK+FGYSFPCDGP
Sbjct: 503 ENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGP 562

Query: 362 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD 541
GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGN +QFNESSTYLMGWLRD
Sbjct: 563 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRD 622

Query: 542 YLWLNSSQL 568
YLWLNSSQL
Sbjct: 623 YLWLNSSQL 631


>sp|Q2PMU2|PSAB_SOYBN Photosystem I P700 chlorophyll a apoprotein A2
OS=Glycine max GN=psaB PE=3 SV=1
Length = 734

Score = 382 bits (980), Expect = e-106
Identities = 173/189 (91%), Positives = 182/189 (96%)
Frame = +2

Query: 2 MLAFGTPEKQILIEPVFAQWIQSAHGKVSYGFDVLLSSVDSPASNVGRGLWLPGWLDAVN 181
MLAFGTPEKQILIEP+FAQWIQSAHGK SYGFD+LLSS +SPA N GR +WLPGWL+AVN
Sbjct: 443 MLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDILLSSTNSPAFNAGRSIWLPGWLNAVN 502

Query: 182 SSNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 361
++NSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKK+FGYSFPCDGP
Sbjct: 503 ENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGP 562

Query: 362 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD 541
GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGN +QFNESSTYLMGWLRD
Sbjct: 563 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRD 622

Query: 542 YLWLNSSQL 568
YLWLNSSQL
Sbjct: 623 YLWLNSSQL 631


>sp|A4GYQ9|PSAB_POPTR Photosystem I P700 chlorophyll a apoprotein A2
OS=Populus trichocarpa GN=psaB PE=3 SV=1
Length = 734

Score = 382 bits (980), Expect = e-106
Identities = 173/189 (91%), Positives = 182/189 (96%)
Frame = +2

Query: 2 MLAFGTPEKQILIEPVFAQWIQSAHGKVSYGFDVLLSSVDSPASNVGRGLWLPGWLDAVN 181
MLAFGTPEKQILIEP+FAQWIQSAHGK SYGFDVLLSS +SPA N GR +WLPGWL+A+N
Sbjct: 443 MLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTNSPAFNAGRSIWLPGWLNAIN 502

Query: 182 SSNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 361
++NSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKK+FGYSFPCDGP
Sbjct: 503 ENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGP 562

Query: 362 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD 541
GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGN +QFNESSTYLMGWLRD
Sbjct: 563 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRD 622

Query: 542 YLWLNSSQL 568
YLWLNSSQL
Sbjct: 623 YLWLNSSQL 631


>sp|Q14FF8|PSAB_POPAL Photosystem I P700 chlorophyll a apoprotein A2
OS=Populus alba GN=psaB PE=3 SV=1
Length = 734

Score = 382 bits (980), Expect = e-106
Identities = 173/189 (91%), Positives = 182/189 (96%)
Frame = +2

Query: 2 MLAFGTPEKQILIEPVFAQWIQSAHGKVSYGFDVLLSSVDSPASNVGRGLWLPGWLDAVN 181
MLAFGTPEKQILIEP+FAQWIQSAHGK SYGFDVLLSS +SPA N GR +WLPGWL+A+N
Sbjct: 443 MLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTNSPAFNAGRSIWLPGWLNAIN 502

Query: 182 SSNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 361
++NSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKK+FGYSFPCDGP
Sbjct: 503 ENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGP 562

Query: 362 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD 541
GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGN +QFNESSTYLMGWLRD
Sbjct: 563 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRD 622

Query: 542 YLWLNSSQL 568
YLWLNSSQL
Sbjct: 623 YLWLNSSQL 631


>sp|Q3BAP1|PSAB_PHAAO Photosystem I P700 chlorophyll a apoprotein A2
OS=Phalaenopsis aphrodite subsp. formosana GN=psaB PE=3
SV=1
Length = 734

Score = 382 bits (980), Expect = e-106
Identities = 173/189 (91%), Positives = 182/189 (96%)
Frame = +2

Query: 2 MLAFGTPEKQILIEPVFAQWIQSAHGKVSYGFDVLLSSVDSPASNVGRGLWLPGWLDAVN 181
MLAFGTPEKQILIEP+FAQWIQSAHGK SYGFDVLLSS +SPA N GR +WLPGWL+A+N
Sbjct: 443 MLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTNSPAFNAGRSIWLPGWLNAIN 502

Query: 182 SSNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 361
++NSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKK+FGYSFPCDGP
Sbjct: 503 ENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGP 562

Query: 362 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD 541
GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGN +QFNESSTYLMGWLRD
Sbjct: 563 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRD 622

Query: 542 YLWLNSSQL 568
YLWLNSSQL
Sbjct: 623 YLWLNSSQL 631


>sp|Q9MTN7|PSAB_OENEH Photosystem I P700 chlorophyll a apoprotein A2
OS=Oenothera elata subsp. hookeri GN=psaB PE=3 SV=2
Length = 734

Score = 382 bits (980), Expect = e-106
Identities = 173/189 (91%), Positives = 182/189 (96%)
Frame = +2

Query: 2 MLAFGTPEKQILIEPVFAQWIQSAHGKVSYGFDVLLSSVDSPASNVGRGLWLPGWLDAVN 181
MLAFGTPEKQILIEP+FAQWIQSAHGK SYGFDVLLSS +SPA N GR +WLPGWL+A+N
Sbjct: 443 MLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTNSPAFNAGRSIWLPGWLNAIN 502

Query: 182 SSNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 361
++NSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKK+FGYSFPCDGP
Sbjct: 503 ENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGP 562

Query: 362 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD 541
GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGN +QFNESSTYLMGWLRD
Sbjct: 563 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRD 622

Query: 542 YLWLNSSQL 568
YLWLNSSQL
Sbjct: 623 YLWLNSSQL 631


tr_hit_id A9QBV8
Definition tr|A9QBV8|A9QBV8_PASBI Photosystem I P700 chlorophyll A apoprotein (Fragment) OS=Passiflora biflora
Align length 189
Score (bit) 384.0
E-value 1.0e-105
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK945442|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0009_F09, 5'
(570 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9QBV8|A9QBV8_PASBI Photosystem I P700 chlorophyll A apoprote... 384 e-105
tr|A7M965|A7M965_CUSRE Photosystem I P700 chlorophyll A apoprote... 382 e-105
tr|B8R4A1|B8R4A1_TRISU Photosystem I P700 apoprotein A2 OS=Trifo... 382 e-104
tr|B5LML7|B5LML7_CICAR Photosystem I P700 apoprotein A2 OS=Cicer... 382 e-104
tr|B1NWE9|B1NWE9_MANES Photosystem I P700 chlorophyll A apoprote... 382 e-104
tr|B0Z5C0|B0Z5C0_OENPA Photosystem I P700 chlorophyll A apoprote... 382 e-104
tr|B0Z536|B0Z536_OENGL Photosystem I P700 chlorophyll A apoprote... 382 e-104
tr|B0Z4V2|B0Z4V2_OENBI Photosystem I P700 chlorophyll A apoprote... 382 e-104
tr|B0Z4L8|B0Z4L8_OENAR Photosystem I P700 chlorophyll A apoprote... 382 e-104
tr|Q4FFJ7|Q4FFJ7_9ASPA Photosystem I P700 chlorophyll A apoprote... 381 e-104
tr|A9QBN8|A9QBN8_MUSAC Photosystem I P700 chlorophyll A apoprote... 380 e-104
tr|A9QAZ2|A9QAZ2_9APIA Photosystem I P700 chlorophyll A apoprote... 380 e-104
tr|Q4FFJ8|Q4FFJ8_TYPLA Photosystem I P700 chlorophyll A apoprote... 380 e-104
tr|Q15B79|Q15B79_TOBAC Photosystem I P700 chlorophyll A apoprote... 380 e-104
tr|B5AH14|B5AH14_9ROSI Photosystem I P700 apoprotein A2 OS=Gonys... 380 e-104
tr|B2XWK4|B2XWK4_FAGEA Photosystem I P700 chlorophyll a apoprote... 380 e-104
tr|B2LMJ2|B2LMJ2_GUIAB Photosystem I P700 apoprotein A2 OS=Guizo... 380 e-104
tr|A8SEA2|A8SEA2_CERDE Photosystem I P700 chlorophyll A apoprote... 380 e-104
tr|A7Y3D1|A7Y3D1_IPOPU Photosystem I P700 chlorophyll A apoprote... 380 e-104
tr|Q4FFJ9|Q4FFJ9_RANMC Photosystem I P700 chlorophyll A apoprote... 380 e-104
tr|Q19KB4|Q19KB4_SOLLC Photosystem I P700 chlorophyll A apoprote... 380 e-104
tr|B3TN50|B3TN50_BRADI PSI p700 apoprotein A2 OS=Brachypodium di... 380 e-104
tr|B1A934|B1A934_CARPA Photosystem I P700 chlorophyll A apoprote... 380 e-104
tr|A9QC32|A9QC32_9ASTR Photosystem I P700 chlorophyll A apoprote... 380 e-104
tr|A9L995|A9L995_LEMMI Photosystem I P700 chlorophyll A apoprote... 380 e-104
tr|A8Y9G9|A8Y9G9_LOLPR Photosystem I P700 chlorophyll A apoprote... 380 e-104
tr|A5BDX5|A5BDX5_VITVI Photosystem I P700 chlorophyll A apoprote... 380 e-104
tr|Q4FFK0|Q4FFK0_NUPAD Photosystem I P700 chlorophyll A apoprote... 379 e-104
tr|A9QBE5|A9QBE5_ELAOL Photosystem I P700 chlorophyll A apoprote... 379 e-104
tr|A9QB69|A9QB69_9SPER Photosystem I P700 chlorophyll A apoprote... 379 e-104

>tr|A9QBV8|A9QBV8_PASBI Photosystem I P700 chlorophyll A apoprotein
(Fragment) OS=Passiflora biflora GN=psaB PE=3 SV=1
Length = 734

Score = 384 bits (985), Expect = e-105
Identities = 174/189 (92%), Positives = 183/189 (96%)
Frame = +2

Query: 2 MLAFGTPEKQILIEPVFAQWIQSAHGKVSYGFDVLLSSVDSPASNVGRGLWLPGWLDAVN 181
MLAFGTPEKQILIEP+FAQWIQSAHGK SYGFDVLLSS++SPA N GR LWLPGWL+A+N
Sbjct: 443 MLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSINSPAFNAGRSLWLPGWLNAIN 502

Query: 182 SSNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 361
++NSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKK+FGYSFPCDGP
Sbjct: 503 ENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGP 562

Query: 362 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD 541
GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGN +QFNESSTYLMGWLRD
Sbjct: 563 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRD 622

Query: 542 YLWLNSSQL 568
YLWLNSSQL
Sbjct: 623 YLWLNSSQL 631


>tr|A7M965|A7M965_CUSRE Photosystem I P700 chlorophyll A apoprotein
OS=Cuscuta reflexa GN=psaB PE=3 SV=1
Length = 734

Score = 382 bits (982), Expect = e-105
Identities = 175/189 (92%), Positives = 180/189 (95%)
Frame = +2

Query: 2 MLAFGTPEKQILIEPVFAQWIQSAHGKVSYGFDVLLSSVDSPASNVGRGLWLPGWLDAVN 181
MLAFGTPEKQILIEP+FAQWIQSAHGK SYGFDVLLSS PA N GR +WLPGWL+AVN
Sbjct: 443 MLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTSGPALNAGRSIWLPGWLNAVN 502

Query: 182 SSNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 361
S+NSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKK+FGYSFPCDGP
Sbjct: 503 DSSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGP 562

Query: 362 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD 541
GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGN AQFNESSTYLMGWLRD
Sbjct: 563 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVAQFNESSTYLMGWLRD 622

Query: 542 YLWLNSSQL 568
YLWLNSSQL
Sbjct: 623 YLWLNSSQL 631


>tr|B8R4A1|B8R4A1_TRISU Photosystem I P700 apoprotein A2 OS=Trifolium
subterraneum GN=psaB PE=4 SV=1
Length = 734

Score = 382 bits (980), Expect = e-104
Identities = 173/189 (91%), Positives = 182/189 (96%)
Frame = +2

Query: 2 MLAFGTPEKQILIEPVFAQWIQSAHGKVSYGFDVLLSSVDSPASNVGRGLWLPGWLDAVN 181
MLAFGTPEKQILIEP+FAQWIQSAHGK SYGFDVLLSS +SPA N GR +WLPGWL+A+N
Sbjct: 443 MLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTNSPALNAGRSIWLPGWLNAIN 502

Query: 182 SSNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 361
++NSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKK+FGYSFPCDGP
Sbjct: 503 ENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGP 562

Query: 362 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD 541
GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGN +QFNESSTYLMGWLRD
Sbjct: 563 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRD 622

Query: 542 YLWLNSSQL 568
YLWLNSSQL
Sbjct: 623 YLWLNSSQL 631


>tr|B5LML7|B5LML7_CICAR Photosystem I P700 apoprotein A2 OS=Cicer
arietinum GN=psaB PE=4 SV=1
Length = 734

Score = 382 bits (980), Expect = e-104
Identities = 173/189 (91%), Positives = 182/189 (96%)
Frame = +2

Query: 2 MLAFGTPEKQILIEPVFAQWIQSAHGKVSYGFDVLLSSVDSPASNVGRGLWLPGWLDAVN 181
MLAFGTPEKQILIEP+FAQWIQSAHGK SYGFDVLLSS +SPA N GR +WLPGWL+A+N
Sbjct: 443 MLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTNSPALNAGRSIWLPGWLNAIN 502

Query: 182 SSNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 361
++NSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKK+FGYSFPCDGP
Sbjct: 503 ENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGP 562

Query: 362 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD 541
GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGN +QFNESSTYLMGWLRD
Sbjct: 563 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRD 622

Query: 542 YLWLNSSQL 568
YLWLNSSQL
Sbjct: 623 YLWLNSSQL 631


>tr|B1NWE9|B1NWE9_MANES Photosystem I P700 chlorophyll A apoprotein
OS=Manihot esculenta GN=psaB PE=3 SV=1
Length = 734

Score = 382 bits (980), Expect = e-104
Identities = 173/189 (91%), Positives = 182/189 (96%)
Frame = +2

Query: 2 MLAFGTPEKQILIEPVFAQWIQSAHGKVSYGFDVLLSSVDSPASNVGRGLWLPGWLDAVN 181
MLAFGTPEKQILIEP+FAQWIQSAHGK SYGFDVLLSS +SPA N GR +WLPGWL+A+N
Sbjct: 443 MLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTNSPAFNAGRSIWLPGWLNAIN 502

Query: 182 SSNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 361
++NSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKK+FGYSFPCDGP
Sbjct: 503 ENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGP 562

Query: 362 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD 541
GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGN +QFNESSTYLMGWLRD
Sbjct: 563 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRD 622

Query: 542 YLWLNSSQL 568
YLWLNSSQL
Sbjct: 623 YLWLNSSQL 631


>tr|B0Z5C0|B0Z5C0_OENPA Photosystem I P700 chlorophyll A apoprotein
OS=Oenothera parviflora GN=psaB PE=3 SV=1
Length = 734

Score = 382 bits (980), Expect = e-104
Identities = 173/189 (91%), Positives = 182/189 (96%)
Frame = +2

Query: 2 MLAFGTPEKQILIEPVFAQWIQSAHGKVSYGFDVLLSSVDSPASNVGRGLWLPGWLDAVN 181
MLAFGTPEKQILIEP+FAQWIQSAHGK SYGFDVLLSS +SPA N GR +WLPGWL+A+N
Sbjct: 443 MLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTNSPAFNAGRSIWLPGWLNAIN 502

Query: 182 SSNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 361
++NSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKK+FGYSFPCDGP
Sbjct: 503 ENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGP 562

Query: 362 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD 541
GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGN +QFNESSTYLMGWLRD
Sbjct: 563 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRD 622

Query: 542 YLWLNSSQL 568
YLWLNSSQL
Sbjct: 623 YLWLNSSQL 631


>tr|B0Z536|B0Z536_OENGL Photosystem I P700 chlorophyll A apoprotein
OS=Oenothera glazioviana GN=psaB PE=3 SV=1
Length = 734

Score = 382 bits (980), Expect = e-104
Identities = 173/189 (91%), Positives = 182/189 (96%)
Frame = +2

Query: 2 MLAFGTPEKQILIEPVFAQWIQSAHGKVSYGFDVLLSSVDSPASNVGRGLWLPGWLDAVN 181
MLAFGTPEKQILIEP+FAQWIQSAHGK SYGFDVLLSS +SPA N GR +WLPGWL+A+N
Sbjct: 443 MLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTNSPAFNAGRSIWLPGWLNAIN 502

Query: 182 SSNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 361
++NSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKK+FGYSFPCDGP
Sbjct: 503 ENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGP 562

Query: 362 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD 541
GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGN +QFNESSTYLMGWLRD
Sbjct: 563 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRD 622

Query: 542 YLWLNSSQL 568
YLWLNSSQL
Sbjct: 623 YLWLNSSQL 631


>tr|B0Z4V2|B0Z4V2_OENBI Photosystem I P700 chlorophyll A apoprotein
OS=Oenothera biennis GN=psaB PE=3 SV=1
Length = 734

Score = 382 bits (980), Expect = e-104
Identities = 173/189 (91%), Positives = 182/189 (96%)
Frame = +2

Query: 2 MLAFGTPEKQILIEPVFAQWIQSAHGKVSYGFDVLLSSVDSPASNVGRGLWLPGWLDAVN 181
MLAFGTPEKQILIEP+FAQWIQSAHGK SYGFDVLLSS +SPA N GR +WLPGWL+A+N
Sbjct: 443 MLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTNSPAFNAGRSIWLPGWLNAIN 502

Query: 182 SSNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 361
++NSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKK+FGYSFPCDGP
Sbjct: 503 ENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGP 562

Query: 362 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD 541
GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGN +QFNESSTYLMGWLRD
Sbjct: 563 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRD 622

Query: 542 YLWLNSSQL 568
YLWLNSSQL
Sbjct: 623 YLWLNSSQL 631


>tr|B0Z4L8|B0Z4L8_OENAR Photosystem I P700 chlorophyll A apoprotein
OS=Oenothera argillicola GN=psaB PE=3 SV=1
Length = 734

Score = 382 bits (980), Expect = e-104
Identities = 173/189 (91%), Positives = 182/189 (96%)
Frame = +2

Query: 2 MLAFGTPEKQILIEPVFAQWIQSAHGKVSYGFDVLLSSVDSPASNVGRGLWLPGWLDAVN 181
MLAFGTPEKQILIEP+FAQWIQSAHGK SYGFDVLLSS +SPA N GR +WLPGWL+A+N
Sbjct: 443 MLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTNSPAFNAGRSIWLPGWLNAIN 502

Query: 182 SSNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 361
++NSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKK+FGYSFPCDGP
Sbjct: 503 ENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGP 562

Query: 362 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD 541
GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGN +QFNESSTYLMGWLRD
Sbjct: 563 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRD 622

Query: 542 YLWLNSSQL 568
YLWLNSSQL
Sbjct: 623 YLWLNSSQL 631


>tr|Q4FFJ7|Q4FFJ7_9ASPA Photosystem I P700 chlorophyll A apoprotein
(Fragment) OS=Yucca schidigera GN=psaB PE=3 SV=1
Length = 734

Score = 381 bits (979), Expect = e-104
Identities = 173/189 (91%), Positives = 180/189 (95%)
Frame = +2

Query: 2 MLAFGTPEKQILIEPVFAQWIQSAHGKVSYGFDVLLSSVDSPASNVGRGLWLPGWLDAVN 181
MLAFGTPEKQILIEP+FAQWIQSAHGK SYGFDVLLSS PA N GR +WLPGWL+A+N
Sbjct: 443 MLAFGTPEKQILIEPIFAQWIQSAHGKTSYGFDVLLSSTTGPAFNAGRSIWLPGWLNAIN 502

Query: 182 SSNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKEFGYSFPCDGP 361
+NNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKK+FGYSFPCDGP
Sbjct: 503 ENNNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGP 562

Query: 362 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNAAQFNESSTYLMGWLRD 541
GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGN +QFNESSTYLMGWLRD
Sbjct: 563 GRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRD 622

Query: 542 YLWLNSSQL 568
YLWLNSSQL
Sbjct: 623 YLWLNSSQL 631