DK945487
Clone id YMU02A01NGRL0009_H16
Library
Length 374
Definition Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0009_H16. 5' end sequence.
Accession
Tissue type young leaves
Developmental stage sporophyte
Contig ID
Sequence
GAGAAAATGGGTGATTCACATTGAGAGGATCACAAGAGAGAAAGTGAATGGTGCTACTGT
GAATGTAGGGATTGACCCCTCTAAGGTGGTGATCACGAAGCTCAAGCTTGACAAGGATAG
GAAGGCGCTGCTTGATAGGAAAGGAAAGGGTAGAGCTGCAGAGAAGGGCAAAGGGAAATT
CACAAGCGAGGAGGTGGCTGCTCCTCTGCAGGAAGTAGATTAATCTTGTAGCGGACTCCT
TTTGCCATGTACATGTCTGGCAGAATTTTGCGATGGTGAGAAACTTCCTAATTTAACTGA
TTTACCCAGTTACATTGAGAAAATTCTGAATACAGATTATGATTAANAAAAAAAAAAAAA
AAAAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id P51414
Definition sp|P51414|RL261_ARATH 60S ribosomal protein L26-1 OS=Arabidopsis thaliana
Align length 32
Score (bit) 63.5
E-value 3.0e-10
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK945487|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0009_H16, 5'
(344 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P51414|RL261_ARATH 60S ribosomal protein L26-1 OS=Arabidopsis... 64 3e-10
sp|Q9FJX2|RL262_ARATH 60S ribosomal protein L26-2 OS=Arabidopsis... 58 2e-08
sp|Q39411|RL26_BRARA 60S ribosomal protein L26 OS=Brassica rapa ... 57 4e-08
sp|Q19869|RL26_CAEEL 60S ribosomal protein L26 OS=Caenorhabditis... 51 2e-06
sp|P61255|RL26_MOUSE 60S ribosomal protein L26 OS=Mus musculus G... 50 3e-06
sp|P61256|RL26_MACFA 60S ribosomal protein L26 OS=Macaca fascicu... 50 3e-06
sp|P61254|RL26_HUMAN 60S ribosomal protein L26 OS=Homo sapiens G... 50 3e-06
sp|P47832|RL26_CHICK 60S ribosomal protein L26 (Fragment) OS=Gal... 50 3e-06
sp|P61257|RL26_BOVIN 60S ribosomal protein L26 OS=Bos taurus GN=... 50 3e-06
sp|Q2I0I6|RL26_AILME 60S ribosomal protein L26 OS=Ailuropoda mel... 50 3e-06
sp|Q9UNX3|RL26L_HUMAN 60S ribosomal protein L26-like 1 OS=Homo s... 50 3e-06
sp|P12749|RL26_RAT 60S ribosomal protein L26 OS=Rattus norvegicu... 50 5e-06
sp|Q95WA0|RL26_LITLI 60S ribosomal protein L26 OS=Littorina litt... 49 6e-06
sp|P78946|RL26_SCHPO 60S ribosomal protein L26 OS=Schizosaccharo... 45 1e-04
sp|Q54QM8|RL26_DICDI 60S ribosomal protein L26 OS=Dictyostelium ... 40 0.003
sp|P53221|RL26B_YEAST 60S ribosomal protein L26-B OS=Saccharomyc... 40 0.003
sp|P05743|RL26A_YEAST 60S ribosomal protein L26-A OS=Saccharomyc... 40 0.003
sp|Q5GH66|XKR5_MOUSE XK-related protein 5 OS=Mus musculus GN=Xkr... 31 2.2
sp|Q29L39|POE_DROPS Protein purity of essence OS=Drosophila pseu... 31 2.2
sp|A1RWS4|RL24_THEPD 50S ribosomal protein L24P OS=Thermofilum p... 30 2.9
sp|B1L777|RL24_KORCO 50S ribosomal protein L24P OS=Korarchaeum c... 30 2.9
sp|Q9UX95|RL24_SULSO 50S ribosomal protein L24P OS=Sulfolobus so... 30 3.7
sp|Q9HB75|PIDD_HUMAN Leucine-rich repeat and death domain-contai... 30 3.7
sp|O74364|YND3_SCHPO Uncharacterized protein C30B4.03c OS=Schizo... 30 4.9
sp|Q9VLT5|POE_DROME Protein purity of essence OS=Drosophila mela... 30 4.9

>sp|P51414|RL261_ARATH 60S ribosomal protein L26-1 OS=Arabidopsis
thaliana GN=RPL26A PE=2 SV=2
Length = 146

Score = 63.5 bits (153), Expect = 3e-10
Identities = 30/32 (93%), Positives = 30/32 (93%)
Frame = +2

Query: 2 RKWVIHIERITREKVNGATVNVGIDPSKVVIT 97
RKWVIHIERITREKVNG TVNVGI PSKVVIT
Sbjct: 75 RKWVIHIERITREKVNGTTVNVGIQPSKVVIT 106


>sp|Q9FJX2|RL262_ARATH 60S ribosomal protein L26-2 OS=Arabidopsis
thaliana GN=RPL26B PE=2 SV=1
Length = 146

Score = 57.8 bits (138), Expect = 2e-08
Identities = 26/32 (81%), Positives = 30/32 (93%)
Frame = +2

Query: 2 RKWVIHIERITREKVNGATVNVGIDPSKVVIT 97
RKWVIHIERITREKVNG+TVNVG++ S V+IT
Sbjct: 75 RKWVIHIERITREKVNGSTVNVGVNASNVMIT 106


>sp|Q39411|RL26_BRARA 60S ribosomal protein L26 OS=Brassica rapa
GN=RPL26 PE=2 SV=1
Length = 146

Score = 56.6 bits (135), Expect = 4e-08
Identities = 26/32 (81%), Positives = 29/32 (90%)
Frame = +2

Query: 2 RKWVIHIERITREKVNGATVNVGIDPSKVVIT 97
RK VIHIER+TREKVNG TVNVG+ P+KVVIT
Sbjct: 75 RKXVIHIERLTREKVNGTTVNVGVQPTKVVIT 106


>sp|Q19869|RL26_CAEEL 60S ribosomal protein L26 OS=Caenorhabditis
elegans GN=rpl-26 PE=2 SV=1
Length = 142

Score = 50.8 bits (120), Expect = 2e-06
Identities = 22/32 (68%), Positives = 29/32 (90%)
Frame = +2

Query: 2 RKWVIHIERITREKVNGATVNVGIDPSKVVIT 97
+K+VIHI++ITREK NG+TV++GI PSKV IT
Sbjct: 75 KKFVIHIDKITREKANGSTVHIGIHPSKVAIT 106


>sp|P61255|RL26_MOUSE 60S ribosomal protein L26 OS=Mus musculus
GN=Rpl26 PE=2 SV=1
Length = 145

Score = 50.1 bits (118), Expect = 3e-06
Identities = 23/32 (71%), Positives = 28/32 (87%)
Frame = +2

Query: 2 RKWVIHIERITREKVNGATVNVGIDPSKVVIT 97
+K+VI+IER+ REK NG TV+VGI PSKVVIT
Sbjct: 76 KKYVIYIERVQREKANGTTVHVGIHPSKVVIT 107


>sp|P61256|RL26_MACFA 60S ribosomal protein L26 OS=Macaca
fascicularis GN=RPL26 PE=2 SV=1
Length = 145

Score = 50.1 bits (118), Expect = 3e-06
Identities = 23/32 (71%), Positives = 28/32 (87%)
Frame = +2

Query: 2 RKWVIHIERITREKVNGATVNVGIDPSKVVIT 97
+K+VI+IER+ REK NG TV+VGI PSKVVIT
Sbjct: 76 KKYVIYIERVQREKANGTTVHVGIHPSKVVIT 107


>sp|P61254|RL26_HUMAN 60S ribosomal protein L26 OS=Homo sapiens
GN=RPL26 PE=1 SV=1
Length = 145

Score = 50.1 bits (118), Expect = 3e-06
Identities = 23/32 (71%), Positives = 28/32 (87%)
Frame = +2

Query: 2 RKWVIHIERITREKVNGATVNVGIDPSKVVIT 97
+K+VI+IER+ REK NG TV+VGI PSKVVIT
Sbjct: 76 KKYVIYIERVQREKANGTTVHVGIHPSKVVIT 107


>sp|P47832|RL26_CHICK 60S ribosomal protein L26 (Fragment) OS=Gallus
gallus GN=RPL26 PE=2 SV=1
Length = 128

Score = 50.1 bits (118), Expect = 3e-06
Identities = 23/32 (71%), Positives = 28/32 (87%)
Frame = +2

Query: 2 RKWVIHIERITREKVNGATVNVGIDPSKVVIT 97
+K+VI+IER+ REK NG TV+VGI PSKVVIT
Sbjct: 59 KKYVIYIERVQREKANGTTVHVGIHPSKVVIT 90


>sp|P61257|RL26_BOVIN 60S ribosomal protein L26 OS=Bos taurus
GN=RPL26 PE=2 SV=1
Length = 145

Score = 50.1 bits (118), Expect = 3e-06
Identities = 23/32 (71%), Positives = 28/32 (87%)
Frame = +2

Query: 2 RKWVIHIERITREKVNGATVNVGIDPSKVVIT 97
+K+VI+IER+ REK NG TV+VGI PSKVVIT
Sbjct: 76 KKYVIYIERVQREKANGTTVHVGIHPSKVVIT 107


>sp|Q2I0I6|RL26_AILME 60S ribosomal protein L26 OS=Ailuropoda
melanoleuca GN=RPL26 PE=2 SV=1
Length = 145

Score = 50.1 bits (118), Expect = 3e-06
Identities = 23/32 (71%), Positives = 28/32 (87%)
Frame = +2

Query: 2 RKWVIHIERITREKVNGATVNVGIDPSKVVIT 97
+K+VI+IER+ REK NG TV+VGI PSKVVIT
Sbjct: 76 KKYVIYIERVQREKANGTTVHVGIHPSKVVIT 107


tr_hit_id A9SE51
Definition tr|A9SE51|A9SE51_PHYPA Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens
Align length 73
Score (bit) 72.8
E-value 8.0e-12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK945487|Adiantum capillus-veneris mRNA, clone:
YMU02A01NGRL0009_H16, 5'
(344 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SE51|A9SE51_PHYPA Predicted protein (Fragment) OS=Physcomit... 73 8e-12
tr|A9SUH7|A9SUH7_PHYPA Predicted protein (Fragment) OS=Physcomit... 72 2e-11
tr|A9NXB2|A9NXB2_PICSI Putative uncharacterized protein OS=Picea... 70 5e-11
tr|A9RV92|A9RV92_PHYPA Predicted protein (Fragment) OS=Physcomit... 70 7e-11
tr|A9RJP0|A9RJP0_PHYPA Predicted protein OS=Physcomitrella paten... 69 9e-11
tr|A9NUP7|A9NUP7_PICSI Putative uncharacterized protein OS=Picea... 69 9e-11
tr|A5AD03|A5AD03_VITVI Putative uncharacterized protein (Chromos... 67 6e-10
tr|Q2QXN5|Q2QXN5_ORYSJ Os12g0150100 protein OS=Oryza sativa subs... 66 8e-10
tr|A2ZI36|A2ZI36_ORYSI Putative uncharacterized protein OS=Oryza... 66 8e-10
tr|Q53Q51|Q53Q51_ORYSJ Ribosomal protein L24, putative (Putative... 65 2e-09
tr|Q53PZ2|Q53PZ2_ORYSJ 60S ribosomal protein L26-1, putative, ex... 65 2e-09
tr|Q0IUK5|Q0IUK5_ORYSJ Os11g0151300 protein (Fragment) OS=Oryza ... 65 2e-09
tr|A2ZBI3|A2ZBI3_ORYSI Putative uncharacterized protein OS=Oryza... 65 2e-09
tr|A9PB00|A9PB00_POPTR Putative uncharacterized protein OS=Popul... 64 3e-09
tr|A9PBY3|A9PBY3_POPTR Putative uncharacterized protein OS=Popul... 64 4e-09
tr|A5AQ64|A5AQ64_VITVI Putative uncharacterized protein (Chromos... 64 4e-09
tr|B4UWB3|B4UWB3_ARAHY Putative L24 ribosomal protein OS=Arachis... 64 5e-09
tr|Q9AWS9|Q9AWS9_ORYSJ Putative ribosomal protein L26 OS=Oryza s... 62 1e-08
tr|Q4U3E9|Q4U3E9_IPOBA Putative L24 ribosomal protein OS=Ipomoea... 62 1e-08
tr|A2WKH0|A2WKH0_ORYSI Putative uncharacterized protein OS=Oryza... 62 1e-08
tr|A9S9V3|A9S9V3_PHYPA Predicted protein OS=Physcomitrella paten... 62 1e-08
tr|O82579|O82579_MAIZE Ribosomal protein L26 (Fragment) OS=Zea m... 61 2e-08
tr|B6TPG2|B6TPG2_MAIZE 60S ribosomal protein L26-1 OS=Zea mays P... 61 2e-08
tr|A9PDH4|A9PDH4_POPTR Putative uncharacterized protein OS=Popul... 61 2e-08
tr|A9P8G8|A9P8G8_POPTR Putative uncharacterized protein OS=Popul... 61 2e-08
tr|A4S5G6|A4S5G6_OSTLU Ribosomal protein L26, component of cytos... 60 7e-08
tr|A8HMG7|A8HMG7_CHLRE Ribosomal protein L26 OS=Chlamydomonas re... 58 3e-07
tr|B6KH63|B6KH63_TOXGO 60S ribosomal protein L26, putative OS=To... 56 1e-06
tr|A9T3L6|A9T3L6_PHYPA Predicted protein (Fragment) OS=Physcomit... 55 1e-06
tr|Q2F6G3|Q2F6G3_ANTEL 60S ribosomal protein L26-like protein (F... 55 2e-06

>tr|A9SE51|A9SE51_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_128273 PE=4 SV=1
Length = 141

Score = 72.8 bits (177), Expect = 8e-12
Identities = 40/73 (54%), Positives = 42/73 (57%)
Frame = +2

Query: 2 RKWVIHIERITREKVNGATVNVGIDPSKVVITXXXXXXXXXXXXXXXXXXXXXXXXXXXF 181
RKWVIH+ERITREKVNGATVNVGID SKVVIT F
Sbjct: 69 RKWVIHVERITREKVNGATVNVGIDASKVVITKLKLDKDRKALLERKGKGRAGDKGKGKF 128

Query: 182 TSEEVAAPLQEVD 220
T +VA PLQEVD
Sbjct: 129 TDADVAPPLQEVD 141


>tr|A9SUH7|A9SUH7_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_135504 PE=4 SV=1
Length = 141

Score = 71.6 bits (174), Expect = 2e-11
Identities = 39/73 (53%), Positives = 42/73 (57%)
Frame = +2

Query: 2 RKWVIHIERITREKVNGATVNVGIDPSKVVITXXXXXXXXXXXXXXXXXXXXXXXXXXXF 181
RKWVIH+ERITREKVNGATVNVGID SKVVIT F
Sbjct: 69 RKWVIHVERITREKVNGATVNVGIDTSKVVITKLKLDKDRKALLERKGKGRAAEKGKGKF 128

Query: 182 TSEEVAAPLQEVD 220
T +V+ PLQEVD
Sbjct: 129 TDADVSPPLQEVD 141


>tr|A9NXB2|A9NXB2_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 147

Score = 70.1 bits (170), Expect = 5e-11
Identities = 34/73 (46%), Positives = 44/73 (60%)
Frame = +2

Query: 2 RKWVIHIERITREKVNGATVNVGIDPSKVVITXXXXXXXXXXXXXXXXXXXXXXXXXXXF 181
+KWVIH+ERITR+KVNG+TVNVG+ PSKV++T F
Sbjct: 75 KKWVIHVERITRDKVNGSTVNVGVHPSKVIVTKLKLDKDRKSLLERKGKGRAAEKGKGKF 134

Query: 182 TSEEVAAPLQEVD 220
T+E+VA PLQ+VD
Sbjct: 135 TAEDVAQPLQDVD 147


>tr|A9RV92|A9RV92_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_119898 PE=4 SV=1
Length = 141

Score = 69.7 bits (169), Expect = 7e-11
Identities = 39/73 (53%), Positives = 42/73 (57%)
Frame = +2

Query: 2 RKWVIHIERITREKVNGATVNVGIDPSKVVITXXXXXXXXXXXXXXXXXXXXXXXXXXXF 181
RKWVIHIERITREKVNGATV+VGID SKVVIT F
Sbjct: 69 RKWVIHIERITREKVNGATVDVGIDTSKVVITKLKLDKDRKALLERKGKGRDADKGKGKF 128

Query: 182 TSEEVAAPLQEVD 220
+ +VA PLQEVD
Sbjct: 129 SDADVAPPLQEVD 141


>tr|A9RJP0|A9RJP0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_67027 PE=4 SV=1
Length = 145

Score = 69.3 bits (168), Expect = 9e-11
Identities = 40/73 (54%), Positives = 43/73 (58%)
Frame = +2

Query: 2 RKWVIHIERITREKVNGATVNVGIDPSKVVITXXXXXXXXXXXXXXXXXXXXXXXXXXXF 181
RKWVIH+ERITREKVNGATVNVGID S VVIT F
Sbjct: 75 RKWVIHVERITREKVNGATVNVGIDTSNVVIT--KLKLDKDRKALLERKGKGRSAEKGKF 132

Query: 182 TSEEVAAPLQEVD 220
T+E+VA PLQEVD
Sbjct: 133 TNEDVAPPLQEVD 145


>tr|A9NUP7|A9NUP7_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 147

Score = 69.3 bits (168), Expect = 9e-11
Identities = 34/73 (46%), Positives = 43/73 (58%)
Frame = +2

Query: 2 RKWVIHIERITREKVNGATVNVGIDPSKVVITXXXXXXXXXXXXXXXXXXXXXXXXXXXF 181
+KWVIH+ERITREKVNG TVNVG+ PSKV++T F
Sbjct: 75 KKWVIHVERITREKVNGQTVNVGVHPSKVIVTKLKIDKDRKDLLERKGKGRAAEKGKGKF 134

Query: 182 TSEEVAAPLQEVD 220
T+++VA PLQ+VD
Sbjct: 135 TADDVAQPLQDVD 147


>tr|A5AD03|A5AD03_VITVI Putative uncharacterized protein (Chromosome
chr14 scaffold_9, whole genome shotgun sequence)
OS=Vitis vinifera GN=GSVIVT00038278001 PE=4 SV=1
Length = 151

Score = 66.6 bits (161), Expect = 6e-10
Identities = 39/77 (50%), Positives = 44/77 (57%), Gaps = 4/77 (5%)
Frame = +2

Query: 2 RKWVIHIERITREKVNGATVNVGIDPSKVVITXXXXXXXXXXXXXXXXXXXXXXXXXXXF 181
RKWVIHIERITREKVNG+TVNVGI+PSKVVI F
Sbjct: 75 RKWVIHIERITREKVNGSTVNVGINPSKVVINKLKLDKDRKSLLDRKAKGRAADKAKGKF 134

Query: 182 TSEEVAA----PLQEVD 220
T+E+VAA LQE+D
Sbjct: 135 TAEDVAAAAAPSLQEID 151


>tr|Q2QXN5|Q2QXN5_ORYSJ Os12g0150100 protein OS=Oryza sativa subsp.
japonica GN=Os12g0150100 PE=2 SV=1
Length = 150

Score = 66.2 bits (160), Expect = 8e-10
Identities = 37/76 (48%), Positives = 44/76 (57%), Gaps = 3/76 (3%)
Frame = +2

Query: 2 RKWVIHIERITREKVNGATVNVGIDPSKVVITXXXXXXXXXXXXXXXXXXXXXXXXXXXF 181
R+WVIH+ERITREKVNG+TVNVGI PSKVV+T F
Sbjct: 75 RRWVIHVERITREKVNGSTVNVGIHPSKVVVTKLKLDKDRKAILDRKASGRAADKAKGKF 134

Query: 182 TSEEVA---APLQEVD 220
T+E+VA A LQE+D
Sbjct: 135 TAEDVAAAGASLQEID 150


>tr|A2ZI36|A2ZI36_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_37478 PE=4 SV=1
Length = 150

Score = 66.2 bits (160), Expect = 8e-10
Identities = 37/76 (48%), Positives = 44/76 (57%), Gaps = 3/76 (3%)
Frame = +2

Query: 2 RKWVIHIERITREKVNGATVNVGIDPSKVVITXXXXXXXXXXXXXXXXXXXXXXXXXXXF 181
R+WVIH+ERITREKVNG+TVNVGI PSKVV+T F
Sbjct: 75 RRWVIHVERITREKVNGSTVNVGIHPSKVVVTKLKLDKDRKAILDRKASGRAADKAKGKF 134

Query: 182 TSEEVA---APLQEVD 220
T+E+VA A LQE+D
Sbjct: 135 TAEDVAAAGASLQEID 150


>tr|Q53Q51|Q53Q51_ORYSJ Ribosomal protein L24, putative (Putative
uncharacterized protein) OS=Oryza sativa subsp. japonica
GN=LOC_Os11g05370 PE=4 SV=1
Length = 153

Score = 65.1 bits (157), Expect = 2e-09
Identities = 37/79 (46%), Positives = 44/79 (55%), Gaps = 6/79 (7%)
Frame = +2

Query: 2 RKWVIHIERITREKVNGATVNVGIDPSKVVITXXXXXXXXXXXXXXXXXXXXXXXXXXXF 181
R+WVIH+ERITREKVNG+TVNVGI PSKVV+T F
Sbjct: 75 RRWVIHVERITREKVNGSTVNVGIHPSKVVVTKLKLDKDRKAILDRKASGRAADKAKGKF 134

Query: 182 TSEEVA------APLQEVD 220
T+E+VA A LQE+D
Sbjct: 135 TAEDVAAAGAAGASLQEID 153