DK949610
Clone id TST38A01NGRL0006_H05
Library
Length 658
Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0006_H05. 5' end sequence.
Accession
Tissue type prothallia
Developmental stage gametophyte
Contig ID
Sequence
GTGGAGTTTAGGAGTTTGCTGTACATCCCAGGAATGGCGCCATTCAATGCTGAGGAGTTG
TATACTGCCAATAACAAAAATATACGGTTATATGTGAAACGTGTATTTATATCTGCCGAT
TTTGACGGGGAATTGCTTCCTCGCTATCTTGGGTTTGTGAAAGGTGTTGTCGATTCAAAC
GACCTTCCTTTAAATGTATCAAGAGAGATACTTCAAGAGAGCCGAATTGTGAGAATCATG
AAAAAGAGGCTTGTCCGAAAAATCTTTGATATGTGTCAAGAAATTGCTGACAGAGAAGAC
AAGGAGGCTTACAAGTCCTTCTGGACCAATTTTGGTCGGAGTATAAAGCTGGGTTGTATC
GAGGATTCTGCAAATCATAAGCGGCTGACTCCACTTCTACGATTTTTCACCTCAAAGCAC
GAAGATAGTCTAGTCAGTCTGAAAACGTATGTCGAAGACATGAAGCCAGAGCAAAATGCC
ATTTATTACTTCGCAGCTGACAGTATCAAAAGTGCTAAAAGCGCTCCTTTTCTTGAGGCA
CTTTTGAAAAAAGATTATGAGGTGCTGTTCCTGATTGAACCCATTGATGAAGTGGCCATC
ACAAATCTTCAAGAGTATGAGGGAAAGAAGTTCGTTGATATTAGCAAAGAGGACTTGG
■■Homology search results ■■ -
sp_hit_id P08110
Definition sp|P08110|ENPL_CHICK Endoplasmin OS=Gallus gallus
Align length 218
Score (bit) 214.0
E-value 3.0e-55
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK949610|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0006_H05, 5'
(658 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P08110|ENPL_CHICK Endoplasmin OS=Gallus gallus GN=HSP90B1 PE=... 214 3e-55
sp|Q66HD0|ENPL_RAT Endoplasmin OS=Rattus norvegicus GN=Hsp90b1 P... 213 9e-55
sp|Q29092|ENPL_PIG Endoplasmin OS=Sus scrofa GN=HSP90B1 PE=2 SV=3 213 9e-55
sp|P08113|ENPL_MOUSE Endoplasmin OS=Mus musculus GN=Hsp90b1 PE=1... 213 9e-55
sp|P41148|ENPL_CANFA Endoplasmin OS=Canis familiaris GN=HSP90B1 ... 213 9e-55
sp|Q95M18|ENPL_BOVIN Endoplasmin OS=Bos taurus GN=HSP90B1 PE=2 SV=1 212 2e-54
sp|Q5R6F7|ENPL_PONAB Endoplasmin OS=Pongo abelii GN=HSP90B1 PE=2... 211 2e-54
sp|Q4R520|ENPL_MACFA Endoplasmin OS=Macaca fascicularis GN=HSP90... 211 2e-54
sp|P14625|ENPL_HUMAN Endoplasmin OS=Homo sapiens GN=HSP90B1 PE=1... 211 2e-54
sp|Q9STX5|ENPL_ARATH Endoplasmin homolog OS=Arabidopsis thaliana... 211 2e-54
sp|P46598|HSP90_CANAL Heat shock protein 90 homolog OS=Candida a... 211 4e-54
sp|P51819|HSP83_IPONI Heat shock protein 83 OS=Ipomoea nil GN=HS... 211 4e-54
sp|P40292|HSP90_ASPFU Heat shock protein 90 OS=Aspergillus fumig... 208 2e-53
sp|P36182|HSP82_TOBAC Heat shock protein 82 (Fragment) OS=Nicoti... 208 2e-53
sp|P24724|HSP90_THEPA Heat shock protein 90 OS=Theileria parva G... 208 2e-53
sp|Q4UDU8|HSP90_THEAN Heat shock protein 90 OS=Theileria annulat... 208 2e-53
sp|P36183|ENPL_HORVU Endoplasmin homolog OS=Hordeum vulgare PE=2... 207 4e-53
sp|O43109|HSP90_PODAN Heat shock protein 90 homolog OS=Podospora... 206 7e-53
sp|P54651|HSC90_DICDI Heat shock cognate 90 kDa protein OS=Dicty... 206 7e-53
sp|P41887|HSP90_SCHPO Heat shock protein 90 homolog OS=Schizosac... 206 1e-52
sp|O61998|HSP90_BRUPA Heat shock protein 90 OS=Brugia pahangi GN... 205 1e-52
sp|P27741|HSP83_LEIAM Heat shock protein 83 OS=Leishmania amazon... 204 3e-52
sp|P35016|ENPL_CATRO Endoplasmin homolog OS=Catharanthus roseus ... 204 3e-52
sp|P46633|HS90A_CRIGR Heat shock protein HSP 90-alpha OS=Cricetu... 204 3e-52
sp|Q08277|HSP82_MAIZE Heat shock protein 82 OS=Zea mays GN=HSP82... 204 4e-52
sp|Q04619|HS90B_CHICK Heat shock cognate protein HSP 90-beta OS=... 204 4e-52
sp|O02705|HS90A_PIG Heat shock protein HSP 90-alpha OS=Sus scrof... 204 4e-52
sp|A5A6K9|HS90A_PANTR Heat shock protein HSP 90-alpha OS=Pan tro... 204 4e-52
sp|Q4R4P1|HS90A_MACFA Heat shock protein HSP 90-alpha OS=Macaca ... 204 4e-52
sp|P07900|HS90A_HUMAN Heat shock protein HSP 90-alpha OS=Homo sa... 204 4e-52

>sp|P08110|ENPL_CHICK Endoplasmin OS=Gallus gallus GN=HSP90B1 PE=1
SV=1
Length = 795

Score = 214 bits (545), Expect = 3e-55
Identities = 108/218 (49%), Positives = 158/218 (72%), Gaps = 1/218 (0%)
Frame = +1

Query: 1 VEFRSLLYIPGMAPFNAEELYTANNKN-IRLYVKRVFISADFDGELLPRYLGFVKGVVDS 177
V F+S+L++P AP + Y + + I+LYV+RVFI+ DF +++P+YL FVKGVVDS
Sbjct: 380 VTFKSILFVPNSAPRGLFDEYGSKKSDFIKLYVRRVFITDDFH-DMMPKYLNFVKGVVDS 438

Query: 178 NDLPLNVSREILQESRIVRIMKKRLVRKIFDMCQEIADREDKEAYKSFWTNFGRSIKLGC 357
+DLPLNVSRE LQ+ +++++++K+LVRK DM ++IA+ + + +FW FG ++KLG
Sbjct: 439 DDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIAEEKYND---TFWKEFGTNVKLGV 495

Query: 358 IEDSANHKRLTPLLRFFTSKHEDSLVSLKTYVEDMKPEQNAIYYFAADSIKSAKSAPFLE 537
IED +N RL LLRF +S HE +L SL YVE MK +Q+ IY+ A S K A+S+PF+E
Sbjct: 496 IEDHSNRTRLAKLLRFQSSHHESNLTSLDQYVERMKEKQDKIYFMAGASRKEAESSPFVE 555

Query: 538 ALLKKDYEVLFLIEPIDEVAITNLQEYEGKKFVDISKE 651
LLKK YEV++L EP+DE I L E++GK+F +++KE
Sbjct: 556 RLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKE 593


>sp|Q66HD0|ENPL_RAT Endoplasmin OS=Rattus norvegicus GN=Hsp90b1 PE=1
SV=2
Length = 804

Score = 213 bits (541), Expect = 9e-55
Identities = 108/218 (49%), Positives = 156/218 (71%), Gaps = 1/218 (0%)
Frame = +1

Query: 1 VEFRSLLYIPGMAPFNAEELYTANNKN-IRLYVKRVFISADFDGELLPRYLGFVKGVVDS 177
V F+S+L++P AP + Y + + I+LYV+RVFI+ DF +++P+YL FVKGVVDS
Sbjct: 381 VTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDDFH-DMMPKYLNFVKGVVDS 439

Query: 178 NDLPLNVSREILQESRIVRIMKKRLVRKIFDMCQEIADREDKEAYKSFWTNFGRSIKLGC 357
+DLPLNVSRE LQ+ +++++++K+LVRK DM ++IAD + + +FW FG +IKLG
Sbjct: 440 DDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEKYND---TFWKEFGTNIKLGV 496

Query: 358 IEDSANHKRLTPLLRFFTSKHEDSLVSLKTYVEDMKPEQNAIYYFAADSIKSAKSAPFLE 537
IED +N RL LLRF +S H + SL YVE MK +Q+ IY+ A S K A+S+PF+E
Sbjct: 497 IEDHSNRTRLAKLLRFQSSHHSTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVE 556

Query: 538 ALLKKDYEVLFLIEPIDEVAITNLQEYEGKKFVDISKE 651
LLKK YEV++L EP+DE I L E++GK+F +++KE
Sbjct: 557 RLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKE 594


>sp|Q29092|ENPL_PIG Endoplasmin OS=Sus scrofa GN=HSP90B1 PE=2 SV=3
Length = 804

Score = 213 bits (541), Expect = 9e-55
Identities = 108/218 (49%), Positives = 156/218 (71%), Gaps = 1/218 (0%)
Frame = +1

Query: 1 VEFRSLLYIPGMAPFNAEELYTANNKN-IRLYVKRVFISADFDGELLPRYLGFVKGVVDS 177
V F+S+L++P AP + Y + + I+LYV+RVFI+ DF +++P+YL FVKGVVDS
Sbjct: 381 VTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDDFH-DMMPKYLNFVKGVVDS 439

Query: 178 NDLPLNVSREILQESRIVRIMKKRLVRKIFDMCQEIADREDKEAYKSFWTNFGRSIKLGC 357
+DLPLNVSRE LQ+ +++++++K+LVRK DM ++IAD + + +FW FG +IKLG
Sbjct: 440 DDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEKYND---TFWKEFGTNIKLGV 496

Query: 358 IEDSANHKRLTPLLRFFTSKHEDSLVSLKTYVEDMKPEQNAIYYFAADSIKSAKSAPFLE 537
IED +N RL LLRF +S H + SL YVE MK +Q+ IY+ A S K A+S+PF+E
Sbjct: 497 IEDHSNRTRLAKLLRFQSSHHPSDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVE 556

Query: 538 ALLKKDYEVLFLIEPIDEVAITNLQEYEGKKFVDISKE 651
LLKK YEV++L EP+DE I L E++GK+F +++KE
Sbjct: 557 RLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKE 594


>sp|P08113|ENPL_MOUSE Endoplasmin OS=Mus musculus GN=Hsp90b1 PE=1 SV=2
Length = 802

Score = 213 bits (541), Expect = 9e-55
Identities = 108/218 (49%), Positives = 156/218 (71%), Gaps = 1/218 (0%)
Frame = +1

Query: 1 VEFRSLLYIPGMAPFNAEELYTANNKN-IRLYVKRVFISADFDGELLPRYLGFVKGVVDS 177
V F+S+L++P AP + Y + + I+LYV+RVFI+ DF +++P+YL FVKGVVDS
Sbjct: 381 VTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDDFH-DMMPKYLNFVKGVVDS 439

Query: 178 NDLPLNVSREILQESRIVRIMKKRLVRKIFDMCQEIADREDKEAYKSFWTNFGRSIKLGC 357
+DLPLNVSRE LQ+ +++++++K+LVRK DM ++IAD + + +FW FG +IKLG
Sbjct: 440 DDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEKYND---TFWKEFGTNIKLGV 496

Query: 358 IEDSANHKRLTPLLRFFTSKHEDSLVSLKTYVEDMKPEQNAIYYFAADSIKSAKSAPFLE 537
IED +N RL LLRF +S H + SL YVE MK +Q+ IY+ A S K A+S+PF+E
Sbjct: 497 IEDHSNRTRLAKLLRFQSSHHSTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVE 556

Query: 538 ALLKKDYEVLFLIEPIDEVAITNLQEYEGKKFVDISKE 651
LLKK YEV++L EP+DE I L E++GK+F +++KE
Sbjct: 557 RLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKE 594


>sp|P41148|ENPL_CANFA Endoplasmin OS=Canis familiaris GN=HSP90B1 PE=1
SV=1
Length = 804

Score = 213 bits (541), Expect = 9e-55
Identities = 108/218 (49%), Positives = 156/218 (71%), Gaps = 1/218 (0%)
Frame = +1

Query: 1 VEFRSLLYIPGMAPFNAEELYTANNKN-IRLYVKRVFISADFDGELLPRYLGFVKGVVDS 177
V F+S+L++P AP + Y + + I+LYV+RVFI+ DF +++P+YL FVKGVVDS
Sbjct: 381 VTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDDFH-DMMPKYLNFVKGVVDS 439

Query: 178 NDLPLNVSREILQESRIVRIMKKRLVRKIFDMCQEIADREDKEAYKSFWTNFGRSIKLGC 357
+DLPLNVSRE LQ+ +++++++K+LVRK DM ++IAD + + +FW FG +IKLG
Sbjct: 440 DDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEKYND---TFWKEFGTNIKLGV 496

Query: 358 IEDSANHKRLTPLLRFFTSKHEDSLVSLKTYVEDMKPEQNAIYYFAADSIKSAKSAPFLE 537
IED +N RL LLRF +S H + SL YVE MK +Q+ IY+ A S K A+S+PF+E
Sbjct: 497 IEDHSNRTRLAKLLRFQSSHHPSDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVE 556

Query: 538 ALLKKDYEVLFLIEPIDEVAITNLQEYEGKKFVDISKE 651
LLKK YEV++L EP+DE I L E++GK+F +++KE
Sbjct: 557 RLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKE 594


>sp|Q95M18|ENPL_BOVIN Endoplasmin OS=Bos taurus GN=HSP90B1 PE=2 SV=1
Length = 804

Score = 212 bits (539), Expect = 2e-54
Identities = 108/218 (49%), Positives = 156/218 (71%), Gaps = 1/218 (0%)
Frame = +1

Query: 1 VEFRSLLYIPGMAPFNAEELYTANNKN-IRLYVKRVFISADFDGELLPRYLGFVKGVVDS 177
V F+S+L++P AP + Y + + I+LYV+RVFI+ DF +++P+YL FVKGVVDS
Sbjct: 381 VTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDDFH-DMMPKYLNFVKGVVDS 439

Query: 178 NDLPLNVSREILQESRIVRIMKKRLVRKIFDMCQEIADREDKEAYKSFWTNFGRSIKLGC 357
+DLPLNVSRE LQ+ +++++++K+LVRK DM ++IAD + + +FW FG +IKLG
Sbjct: 440 DDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEKYND---TFWKEFGTNIKLGV 496

Query: 358 IEDSANHKRLTPLLRFFTSKHEDSLVSLKTYVEDMKPEQNAIYYFAADSIKSAKSAPFLE 537
IED +N RL LLRF +S H + SL YVE MK +Q+ IY+ A S K A+S+PF+E
Sbjct: 497 IEDHSNRTRLAKLLRFQSSHHPSDMTSLDQYVERMKEKQDKIYFMAGASRKEAESSPFVE 556

Query: 538 ALLKKDYEVLFLIEPIDEVAITNLQEYEGKKFVDISKE 651
LLKK YEV++L EP+DE I L E++GK+F +++KE
Sbjct: 557 RLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKE 594


>sp|Q5R6F7|ENPL_PONAB Endoplasmin OS=Pongo abelii GN=HSP90B1 PE=2 SV=1
Length = 804

Score = 211 bits (538), Expect = 2e-54
Identities = 108/218 (49%), Positives = 156/218 (71%), Gaps = 1/218 (0%)
Frame = +1

Query: 1 VEFRSLLYIPGMAPFNAEELYTANNKN-IRLYVKRVFISADFDGELLPRYLGFVKGVVDS 177
V F+S+L++P AP + Y + + I+LYV+RVFI+ DF +++P+YL FVKGVVDS
Sbjct: 381 VTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDDFH-DMMPKYLNFVKGVVDS 439

Query: 178 NDLPLNVSREILQESRIVRIMKKRLVRKIFDMCQEIADREDKEAYKSFWTNFGRSIKLGC 357
+DLPLNVSRE LQ+ +++++++K+LVRK DM ++IAD + + +FW FG +IKLG
Sbjct: 440 DDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKYND---TFWKEFGTNIKLGV 496

Query: 358 IEDSANHKRLTPLLRFFTSKHEDSLVSLKTYVEDMKPEQNAIYYFAADSIKSAKSAPFLE 537
IED +N RL LLRF +S H + SL YVE MK +Q+ IY+ A S K A+S+PF+E
Sbjct: 497 IEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVE 556

Query: 538 ALLKKDYEVLFLIEPIDEVAITNLQEYEGKKFVDISKE 651
LLKK YEV++L EP+DE I L E++GK+F +++KE
Sbjct: 557 RLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKE 594


>sp|Q4R520|ENPL_MACFA Endoplasmin OS=Macaca fascicularis GN=HSP90B1
PE=2 SV=1
Length = 804

Score = 211 bits (538), Expect = 2e-54
Identities = 108/218 (49%), Positives = 156/218 (71%), Gaps = 1/218 (0%)
Frame = +1

Query: 1 VEFRSLLYIPGMAPFNAEELYTANNKN-IRLYVKRVFISADFDGELLPRYLGFVKGVVDS 177
V F+S+L++P AP + Y + + I+LYV+RVFI+ DF +++P+YL FVKGVVDS
Sbjct: 381 VTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDDFH-DMMPKYLNFVKGVVDS 439

Query: 178 NDLPLNVSREILQESRIVRIMKKRLVRKIFDMCQEIADREDKEAYKSFWTNFGRSIKLGC 357
+DLPLNVSRE LQ+ +++++++K+LVRK DM ++IAD + + +FW FG +IKLG
Sbjct: 440 DDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKYND---TFWKEFGTNIKLGV 496

Query: 358 IEDSANHKRLTPLLRFFTSKHEDSLVSLKTYVEDMKPEQNAIYYFAADSIKSAKSAPFLE 537
IED +N RL LLRF +S H + SL YVE MK +Q+ IY+ A S K A+S+PF+E
Sbjct: 497 IEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVE 556

Query: 538 ALLKKDYEVLFLIEPIDEVAITNLQEYEGKKFVDISKE 651
LLKK YEV++L EP+DE I L E++GK+F +++KE
Sbjct: 557 RLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKE 594


>sp|P14625|ENPL_HUMAN Endoplasmin OS=Homo sapiens GN=HSP90B1 PE=1 SV=1
Length = 803

Score = 211 bits (538), Expect = 2e-54
Identities = 108/218 (49%), Positives = 156/218 (71%), Gaps = 1/218 (0%)
Frame = +1

Query: 1 VEFRSLLYIPGMAPFNAEELYTANNKN-IRLYVKRVFISADFDGELLPRYLGFVKGVVDS 177
V F+S+L++P AP + Y + + I+LYV+RVFI+ DF +++P+YL FVKGVVDS
Sbjct: 381 VTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDDFH-DMMPKYLNFVKGVVDS 439

Query: 178 NDLPLNVSREILQESRIVRIMKKRLVRKIFDMCQEIADREDKEAYKSFWTNFGRSIKLGC 357
+DLPLNVSRE LQ+ +++++++K+LVRK DM ++IAD + + +FW FG +IKLG
Sbjct: 440 DDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKYND---TFWKEFGTNIKLGV 496

Query: 358 IEDSANHKRLTPLLRFFTSKHEDSLVSLKTYVEDMKPEQNAIYYFAADSIKSAKSAPFLE 537
IED +N RL LLRF +S H + SL YVE MK +Q+ IY+ A S K A+S+PF+E
Sbjct: 497 IEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYFMAGSSRKEAESSPFVE 556

Query: 538 ALLKKDYEVLFLIEPIDEVAITNLQEYEGKKFVDISKE 651
LLKK YEV++L EP+DE I L E++GK+F +++KE
Sbjct: 557 RLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKE 594


>sp|Q9STX5|ENPL_ARATH Endoplasmin homolog OS=Arabidopsis thaliana
GN=SHD PE=1 SV=1
Length = 823

Score = 211 bits (538), Expect = 2e-54
Identities = 110/240 (45%), Positives = 154/240 (64%), Gaps = 21/240 (8%)
Frame = +1

Query: 1 VEFRSLLYIPGMAPFNA-EELYTANNKNIRLYVKRVFISADFDGELLPRYLGFVKGVVDS 177
VEF+++LY+P AP + E Y +N N++LYV+RVFIS +FD ELLP+YL F+KG+VDS
Sbjct: 388 VEFKAVLYVPPKAPHDLYESYYNSNKANLKLYVRRVFISDEFD-ELLPKYLSFLKGLVDS 446

Query: 178 NDLPLNVSREILQESRIVRIMKKRLVRKIFDMCQEIADR--------------------E 297
+ LPLNVSRE+LQ+ ++ +KK+L+RK DM +++A+ E
Sbjct: 447 DTLPLNVSREMLQQHSSLKTIKKKLIRKALDMIRKLAEEDPDEIHDDEKKDVEKSGENDE 506

Query: 298 DKEAYKSFWTNFGRSIKLGCIEDSANHKRLTPLLRFFTSKHEDSLVSLKTYVEDMKPEQN 477
K Y FW FG+S+KLG IED+AN RL LLRF T+K + L SL Y++ MK Q
Sbjct: 507 KKGQYTKFWNEFGKSVKLGIIEDAANRNRLAKLLRFETTKSDGKLTSLDQYIKRMKKSQK 566

Query: 478 AIYYFAADSIKSAKSAPFLEALLKKDYEVLFLIEPIDEVAITNLQEYEGKKFVDISKEDL 657
I+Y S + + +PFLE L+KK YEV+F +P+DE + L +YE KKF ++SKE L
Sbjct: 567 DIFYITGSSKEQLEKSPFLERLIKKGYEVIFFTDPVDEYLMQYLMDYEDKKFQNVSKEGL 626


tr_hit_id A9SU16
Definition tr|A9SU16|A9SU16_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 219
Score (bit) 338.0
E-value 1.0e-91
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK949610|Adiantum capillus-veneris mRNA, clone:
TST38A01NGRL0006_H05, 5'
(658 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SU16|A9SU16_PHYPA Predicted protein OS=Physcomitrella paten... 338 1e-91
tr|B8BCQ3|B8BCQ3_ORYSI Putative uncharacterized protein OS=Oryza... 330 6e-89
tr|A3BZV5|A3BZV5_ORYSJ Putative uncharacterized protein OS=Oryza... 329 8e-89
tr|Q9SIF2|Q9SIF2_ARATH Putative heat shock protein (At2g04030/F3... 328 1e-88
tr|Q8LPS0|Q8LPS0_ARATH At2g04030/F3C11.14 OS=Arabidopsis thalian... 328 1e-88
tr|Q6ZCV7|Q6ZCV7_ORYSJ Os08g0487800 protein OS=Oryza sativa subs... 326 7e-88
tr|B8BC47|B8BC47_ORYSI Putative uncharacterized protein OS=Oryza... 326 7e-88
tr|A7PNA3|A7PNA3_VITVI Chromosome chr1 scaffold_22, whole genome... 326 7e-88
tr|A3BUA7|A3BUA7_ORYSJ Putative uncharacterized protein OS=Oryza... 326 7e-88
tr|O23638|O23638_ARATH Heat shock protein OS=Arabidopsis thalian... 324 3e-87
tr|Q43638|Q43638_SECCE Heat-shock protein OS=Secale cereale PE=2... 320 6e-86
tr|Q3EC72|Q3EC72_ARATH Uncharacterized protein At2g04030.2 OS=Ar... 319 8e-86
tr|A5AEP7|A5AEP7_VITVI Putative uncharacterized protein OS=Vitis... 310 4e-83
tr|A7Q331|A7Q331_VITVI Chromosome chr12 scaffold_47, whole genom... 308 3e-82
tr|Q9S7E7|Q9S7E7_ARATH Putative heat-shock protein OS=Arabidopsi... 301 2e-80
tr|Q0WRS4|Q0WRS4_ARATH Putative heat shock protein OS=Arabidopsi... 301 2e-80
tr|A9TMP2|A9TMP2_PHYPA Predicted protein OS=Physcomitrella paten... 295 2e-78
tr|Q0IN14|Q0IN14_ORYSJ Os12g0514500 protein OS=Oryza sativa subs... 294 3e-78
tr|B8BM57|B8BM57_ORYSI Putative uncharacterized protein OS=Oryza... 294 3e-78
tr|A3CHV0|A3CHV0_ORYSJ Putative uncharacterized protein OS=Oryza... 294 3e-78
tr|A9RPE9|A9RPE9_PHYPA Predicted protein OS=Physcomitrella paten... 290 7e-77
tr|Q0J0Z5|Q0J0Z5_ORYSJ Os09g0474300 protein OS=Oryza sativa subs... 280 4e-74
tr|Q0WMQ3|Q0WMQ3_ARATH Heat shock like protein (Fragment) OS=Ara... 258 3e-67
tr|Q66T67|Q66T67_CHLRE Heat shock protein 90C OS=Chlamydomonas r... 251 2e-65
tr|Q01H64|Q01H64_OSTTA Heat shock protein 90C (ISS) OS=Ostreococ... 245 2e-63
tr|A4RQD9|A4RQD9_OSTLU Heat Shock Protein 90 OS=Ostreococcus luc... 244 3e-63
tr|B7GEF7|B7GEF7_PHATR Heat shock protein Hsp90 OS=Phaeodactylum... 227 4e-58
tr|B8BY36|B8BY36_THAPS Heat shock protein OS=Thalassiosira pseud... 224 5e-57
tr|Q5DK74|Q5DK74_GUITH Heat shock protein 90 (Fragment) OS=Guill... 219 9e-56
tr|A7M6N7|A7M6N7_9DINO Heat shock protein 90 (Fragment) OS=Nocti... 217 6e-55

>tr|A9SU16|A9SU16_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_215726 PE=4 SV=1
Length = 695

Score = 338 bits (868), Expect = 1e-91
Identities = 166/219 (75%), Positives = 191/219 (87%)
Frame = +1

Query: 1 VEFRSLLYIPGMAPFNAEELYTANNKNIRLYVKRVFISADFDGELLPRYLGFVKGVVDSN 180
+EF+SLLYIPGMAPFN+E++ + KNIRLYVKRVFIS +FDGEL PRYLGFVKGVVDSN
Sbjct: 286 IEFKSLLYIPGMAPFNSEDMVSGKTKNIRLYVKRVFISDEFDGELFPRYLGFVKGVVDSN 345

Query: 181 DLPLNVSREILQESRIVRIMKKRLVRKIFDMCQEIADREDKEAYKSFWTNFGRSIKLGCI 360
DLPLNVSREILQESRIVRIMKKRLVRK FDM +EIA+RE KE YK FWT+FG+++KLGC+
Sbjct: 346 DLPLNVSREILQESRIVRIMKKRLVRKTFDMIEEIANREKKEDYKQFWTSFGKNLKLGCV 405

Query: 361 EDSANHKRLTPLLRFFTSKHEDSLVSLKTYVEDMKPEQNAIYYFAADSIKSAKSAPFLEA 540
ED+ANHKRL PLLRF +SK E+ L+SL YVE MK +Q IYY AADS+KSAKSAPFLE
Sbjct: 406 EDTANHKRLAPLLRFNSSKKEEELISLDEYVEGMKEDQKEIYYLAADSLKSAKSAPFLEE 465

Query: 541 LLKKDYEVLFLIEPIDEVAITNLQEYEGKKFVDISKEDL 657
L+K+D EVL L+EPIDEVAI+NLQ Y+ KKF DISKEDL
Sbjct: 466 LVKRDMEVLLLVEPIDEVAISNLQSYKDKKFADISKEDL 504


>tr|B8BCQ3|B8BCQ3_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_31743 PE=4 SV=1
Length = 794

Score = 330 bits (845), Expect = 6e-89
Identities = 164/219 (74%), Positives = 187/219 (85%)
Frame = +1

Query: 1 VEFRSLLYIPGMAPFNAEELYTANNKNIRLYVKRVFISADFDGELLPRYLGFVKGVVDSN 180
VEFRS+LYIPGMAP + EE+ KNIRLYVKRVFIS DFDGEL PRYL FVKGVVDSN
Sbjct: 385 VEFRSVLYIPGMAPLSNEEIMNPKTKNIRLYVKRVFISDDFDGELFPRYLSFVKGVVDSN 444

Query: 181 DLPLNVSREILQESRIVRIMKKRLVRKIFDMCQEIADREDKEAYKSFWTNFGRSIKLGCI 360
DLPLNVSREILQESRIVRIM+KRLVRK FDM QEIA++EDKE YK FW +FG+ +KLGCI
Sbjct: 445 DLPLNVSREILQESRIVRIMRKRLVRKTFDMIQEIAEKEDKEDYKKFWESFGKFVKLGCI 504

Query: 361 EDSANHKRLTPLLRFFTSKHEDSLVSLKTYVEDMKPEQNAIYYFAADSIKSAKSAPFLEA 540
ED+ NHKRL+PLLRF++SK+E L+SL YVE+M Q AIYY A DS++SAK+APFLE
Sbjct: 505 EDTGNHKRLSPLLRFYSSKNETDLISLDQYVENMPENQKAIYYIATDSLQSAKTAPFLEK 564

Query: 541 LLKKDYEVLFLIEPIDEVAITNLQEYEGKKFVDISKEDL 657
L++KD EVL+LIEPIDEVAI NLQ Y+ KKFVDISKEDL
Sbjct: 565 LVQKDIEVLYLIEPIDEVAIQNLQTYKEKKFVDISKEDL 603


>tr|A3BZV5|A3BZV5_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_028577 PE=4 SV=1
Length = 913

Score = 329 bits (844), Expect = 8e-89
Identities = 164/219 (74%), Positives = 186/219 (84%)
Frame = +1

Query: 1 VEFRSLLYIPGMAPFNAEELYTANNKNIRLYVKRVFISADFDGELLPRYLGFVKGVVDSN 180
VEFRS+LYIPGMAP + EE+ KNIRLYVKRVFIS DFDGEL PRYL FVKGVVDSN
Sbjct: 504 VEFRSVLYIPGMAPLSNEEIMNPKTKNIRLYVKRVFISDDFDGELFPRYLSFVKGVVDSN 563

Query: 181 DLPLNVSREILQESRIVRIMKKRLVRKIFDMCQEIADREDKEAYKSFWTNFGRSIKLGCI 360
DLPLNVSREILQESRIVRIM+KRLVRK FDM QEIA++EDKE YK FW +FG+ +KLGCI
Sbjct: 564 DLPLNVSREILQESRIVRIMRKRLVRKTFDMIQEIAEKEDKEDYKKFWESFGKFVKLGCI 623

Query: 361 EDSANHKRLTPLLRFFTSKHEDSLVSLKTYVEDMKPEQNAIYYFAADSIKSAKSAPFLEA 540
ED+ NHKRL PLLRF++SK+E L+SL YVE+M Q AIYY A DS++SAK+APFLE
Sbjct: 624 EDTGNHKRLAPLLRFYSSKNETDLISLDQYVENMPENQKAIYYIATDSLQSAKTAPFLEK 683

Query: 541 LLKKDYEVLFLIEPIDEVAITNLQEYEGKKFVDISKEDL 657
L++KD EVL+LIEPIDEVAI NLQ Y+ KKFVDISKEDL
Sbjct: 684 LVQKDIEVLYLIEPIDEVAIQNLQTYKEKKFVDISKEDL 722



Score = 279 bits (713), Expect = 1e-73
Identities = 137/187 (73%), Positives = 157/187 (83%)
Frame = +1

Query: 1 VEFRSLLYIPGMAPFNAEELYTANNKNIRLYVKRVFISADFDGELLPRYLGFVKGVVDSN 180
VEFRS+LYIPGMAP + EE+ KNIRLYVKRVFIS DFDGEL PRYL FVKGVVDSN
Sbjct: 315 VEFRSVLYIPGMAPLSNEEIMNPKTKNIRLYVKRVFISDDFDGELFPRYLSFVKGVVDSN 374

Query: 181 DLPLNVSREILQESRIVRIMKKRLVRKIFDMCQEIADREDKEAYKSFWTNFGRSIKLGCI 360
DLPLNVSREILQESRIVRIM+KRLVRK FDM QEIA++EDKE YK FW +FG+ +KLGCI
Sbjct: 375 DLPLNVSREILQESRIVRIMRKRLVRKTFDMIQEIAEKEDKEDYKKFWESFGKFVKLGCI 434

Query: 361 EDSANHKRLTPLLRFFTSKHEDSLVSLKTYVEDMKPEQNAIYYFAADSIKSAKSAPFLEA 540
ED+ NHKRL PLLRF++SK+E L+SL YVE+M Q AIYY A DS++SAK+APFLE
Sbjct: 435 EDTGNHKRLAPLLRFYSSKNETDLISLDQYVENMPENQKAIYYIATDSLQSAKTAPFLEK 494

Query: 541 LLKKDYE 561
L++KD E
Sbjct: 495 LVQKDIE 501


>tr|Q9SIF2|Q9SIF2_ARATH Putative heat shock protein
(At2g04030/F3C11.14) OS=Arabidopsis thaliana GN=At2g04030
PE=2 SV=1
Length = 780

Score = 328 bits (842), Expect = 1e-88
Identities = 162/219 (73%), Positives = 185/219 (84%)
Frame = +1

Query: 1 VEFRSLLYIPGMAPFNAEELYTANNKNIRLYVKRVFISADFDGELLPRYLGFVKGVVDSN 180
VEFRS+LYIPGM P N E++ KNIRLYVKRVFIS DFDGEL PRYL FVKGVVDS+
Sbjct: 374 VEFRSILYIPGMGPLNNEDVTNPKTKNIRLYVKRVFISDDFDGELFPRYLSFVKGVVDSD 433

Query: 181 DLPLNVSREILQESRIVRIMKKRLVRKIFDMCQEIADREDKEAYKSFWTNFGRSIKLGCI 360
DLPLNVSREILQESRIVRIM+KRL+RK FDM QEI++ E+KE YK FW NFGR +KLGCI
Sbjct: 434 DLPLNVSREILQESRIVRIMRKRLIRKTFDMIQEISESENKEDYKKFWENFGRFLKLGCI 493

Query: 361 EDSANHKRLTPLLRFFTSKHEDSLVSLKTYVEDMKPEQNAIYYFAADSIKSAKSAPFLEA 540
ED+ NHKR+TPLLRFF+SK+E+ L SL Y+E+M Q AIYY A DS+KSAKSAPFLE
Sbjct: 494 EDTGNHKRITPLLRFFSSKNEEELTSLDDYIENMGENQKAIYYLATDSLKSAKSAPFLEK 553

Query: 541 LLKKDYEVLFLIEPIDEVAITNLQEYEGKKFVDISKEDL 657
L++KD EVL+L+EPIDEVAI NLQ Y+ KKFVDISKEDL
Sbjct: 554 LIQKDIEVLYLVEPIDEVAIQNLQTYKEKKFVDISKEDL 592


>tr|Q8LPS0|Q8LPS0_ARATH At2g04030/F3C11.14 OS=Arabidopsis thaliana
PE=2 SV=1
Length = 780

Score = 328 bits (842), Expect = 1e-88
Identities = 162/219 (73%), Positives = 185/219 (84%)
Frame = +1

Query: 1 VEFRSLLYIPGMAPFNAEELYTANNKNIRLYVKRVFISADFDGELLPRYLGFVKGVVDSN 180
VEFRS+LYIPGM P N E++ KNIRLYVKRVFIS DFDGEL PRYL FVKGVVDS+
Sbjct: 374 VEFRSILYIPGMGPLNNEDVTNPKTKNIRLYVKRVFISDDFDGELFPRYLSFVKGVVDSD 433

Query: 181 DLPLNVSREILQESRIVRIMKKRLVRKIFDMCQEIADREDKEAYKSFWTNFGRSIKLGCI 360
DLPLNVSREILQESRIVRIM+KRL+RK FDM QEI++ E+KE YK FW NFGR +KLGCI
Sbjct: 434 DLPLNVSREILQESRIVRIMRKRLIRKTFDMIQEISESENKEDYKKFWENFGRFLKLGCI 493

Query: 361 EDSANHKRLTPLLRFFTSKHEDSLVSLKTYVEDMKPEQNAIYYFAADSIKSAKSAPFLEA 540
ED+ NHKR+TPLLRFF+SK+E+ L SL Y+E+M Q AIYY A DS+KSAKSAPFLE
Sbjct: 494 EDTGNHKRITPLLRFFSSKNEEELTSLDDYIENMGENQKAIYYLATDSLKSAKSAPFLEK 553

Query: 541 LLKKDYEVLFLIEPIDEVAITNLQEYEGKKFVDISKEDL 657
L++KD EVL+L+EPIDEVAI NLQ Y+ KKFVDISKEDL
Sbjct: 554 LIQKDIEVLYLVEPIDEVAIQNLQTYKEKKFVDISKEDL 592


>tr|Q6ZCV7|Q6ZCV7_ORYSJ Os08g0487800 protein OS=Oryza sativa subsp.
japonica GN=P0028A08.21 PE=4 SV=1
Length = 785

Score = 326 bits (836), Expect = 7e-88
Identities = 163/219 (74%), Positives = 185/219 (84%)
Frame = +1

Query: 1 VEFRSLLYIPGMAPFNAEELYTANNKNIRLYVKRVFISADFDGELLPRYLGFVKGVVDSN 180
VEFRS+LYIPGMAP + EE+ KNIRLYVKRVFIS DFDGEL PRYL FVKGVVDSN
Sbjct: 375 VEFRSVLYIPGMAPLSNEEIMNPKTKNIRLYVKRVFISDDFDGELFPRYLSFVKGVVDSN 434

Query: 181 DLPLNVSREILQESRIVRIMKKRLVRKIFDMCQEIADREDKEAYKSFWTNFGRSIKLGCI 360
DLPLNVSREILQESRIVRIM+KRLVRK FDM +EI++++DKE YK FW +FG+ IKLGCI
Sbjct: 435 DLPLNVSREILQESRIVRIMRKRLVRKTFDMIEEISEKDDKEDYKKFWESFGKFIKLGCI 494

Query: 361 EDSANHKRLTPLLRFFTSKHEDSLVSLKTYVEDMKPEQNAIYYFAADSIKSAKSAPFLEA 540
ED+ NHKRL PLLRF TSK+E L+SL YVE+M Q AIYY A DS++SAK+APFLE
Sbjct: 495 EDTGNHKRLAPLLRFHTSKNEGDLISLDQYVENMPENQKAIYYIATDSLQSAKTAPFLEK 554

Query: 541 LLKKDYEVLFLIEPIDEVAITNLQEYEGKKFVDISKEDL 657
L++KD EVL+LIEPIDEVAI NLQ Y+ KKFVDISKEDL
Sbjct: 555 LVQKDIEVLYLIEPIDEVAIQNLQTYKEKKFVDISKEDL 593


>tr|B8BC47|B8BC47_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_29679 PE=4 SV=1
Length = 785

Score = 326 bits (836), Expect = 7e-88
Identities = 163/219 (74%), Positives = 185/219 (84%)
Frame = +1

Query: 1 VEFRSLLYIPGMAPFNAEELYTANNKNIRLYVKRVFISADFDGELLPRYLGFVKGVVDSN 180
VEFRS+LYIPGMAP + EE+ KNIRLYVKRVFIS DFDGEL PRYL FVKGVVDSN
Sbjct: 375 VEFRSVLYIPGMAPLSNEEIMNPKTKNIRLYVKRVFISDDFDGELFPRYLSFVKGVVDSN 434

Query: 181 DLPLNVSREILQESRIVRIMKKRLVRKIFDMCQEIADREDKEAYKSFWTNFGRSIKLGCI 360
DLPLNVSREILQESRIVRIM+KRLVRK FDM +EI++++DKE YK FW +FG+ IKLGCI
Sbjct: 435 DLPLNVSREILQESRIVRIMRKRLVRKTFDMIEEISEKDDKEDYKKFWESFGKFIKLGCI 494

Query: 361 EDSANHKRLTPLLRFFTSKHEDSLVSLKTYVEDMKPEQNAIYYFAADSIKSAKSAPFLEA 540
ED+ NHKRL PLLRF TSK+E L+SL YVE+M Q AIYY A DS++SAK+APFLE
Sbjct: 495 EDTGNHKRLAPLLRFHTSKNEGDLISLDQYVENMPENQKAIYYIATDSLQSAKTAPFLEK 554

Query: 541 LLKKDYEVLFLIEPIDEVAITNLQEYEGKKFVDISKEDL 657
L++KD EVL+LIEPIDEVAI NLQ Y+ KKFVDISKEDL
Sbjct: 555 LVQKDIEVLYLIEPIDEVAIQNLQTYKEKKFVDISKEDL 593


>tr|A7PNA3|A7PNA3_VITVI Chromosome chr1 scaffold_22, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00021159001
PE=4 SV=1
Length = 792

Score = 326 bits (836), Expect = 7e-88
Identities = 163/219 (74%), Positives = 183/219 (83%)
Frame = +1

Query: 1 VEFRSLLYIPGMAPFNAEELYTANNKNIRLYVKRVFISADFDGELLPRYLGFVKGVVDSN 180
VEFRS+LYIPGM P N E++ KNIRLYVKRVFIS DFDGEL PRYL FVKGVVDS+
Sbjct: 380 VEFRSILYIPGMGPLNNEDVMNPKTKNIRLYVKRVFISDDFDGELFPRYLSFVKGVVDSD 439

Query: 181 DLPLNVSREILQESRIVRIMKKRLVRKIFDMCQEIADREDKEAYKSFWTNFGRSIKLGCI 360
DLPLNVSREILQESRIVRIM+KRLVRK FDM QE+++ E+KE YK FW NFGR +KLGCI
Sbjct: 440 DLPLNVSREILQESRIVRIMRKRLVRKTFDMIQEVSESENKEDYKKFWENFGRFLKLGCI 499

Query: 361 EDSANHKRLTPLLRFFTSKHEDSLVSLKTYVEDMKPEQNAIYYFAADSIKSAKSAPFLEA 540
ED+ NHKR+TPLLRF TSK E+ L SL YVE+M Q AIYY A DS+KSAK+APFLE
Sbjct: 500 EDTGNHKRITPLLRFHTSKSEEELTSLDDYVENMGENQKAIYYLATDSLKSAKTAPFLEK 559

Query: 541 LLKKDYEVLFLIEPIDEVAITNLQEYEGKKFVDISKEDL 657
L++KD EVL+LIEPIDEVAI NLQ Y+ KKFVDISKEDL
Sbjct: 560 LVQKDIEVLYLIEPIDEVAIQNLQTYKEKKFVDISKEDL 598


>tr|A3BUA7|A3BUA7_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_026629 PE=4 SV=1
Length = 1164

Score = 326 bits (836), Expect = 7e-88
Identities = 163/219 (74%), Positives = 185/219 (84%)
Frame = +1

Query: 1 VEFRSLLYIPGMAPFNAEELYTANNKNIRLYVKRVFISADFDGELLPRYLGFVKGVVDSN 180
VEFRS+LYIPGMAP + EE+ KNIRLYVKRVFIS DFDGEL PRYL FVKGVVDSN
Sbjct: 753 VEFRSVLYIPGMAPLSNEEIMNPKTKNIRLYVKRVFISDDFDGELFPRYLSFVKGVVDSN 812

Query: 181 DLPLNVSREILQESRIVRIMKKRLVRKIFDMCQEIADREDKEAYKSFWTNFGRSIKLGCI 360
DLPLNVSREILQESRIVRIM+KRLVRK FDM +EI++++DKE YK FW +FG+ IKLGCI
Sbjct: 813 DLPLNVSREILQESRIVRIMRKRLVRKTFDMIEEISEKDDKEDYKKFWESFGKFIKLGCI 872

Query: 361 EDSANHKRLTPLLRFFTSKHEDSLVSLKTYVEDMKPEQNAIYYFAADSIKSAKSAPFLEA 540
ED+ NHKRL PLLRF TSK+E L+SL YVE+M Q AIYY A DS++SAK+APFLE
Sbjct: 873 EDTGNHKRLAPLLRFHTSKNEGDLISLDQYVENMPENQKAIYYIATDSLQSAKTAPFLEK 932

Query: 541 LLKKDYEVLFLIEPIDEVAITNLQEYEGKKFVDISKEDL 657
L++KD EVL+LIEPIDEVAI NLQ Y+ KKFVDISKEDL
Sbjct: 933 LVQKDIEVLYLIEPIDEVAIQNLQTYKEKKFVDISKEDL 971


>tr|O23638|O23638_ARATH Heat shock protein OS=Arabidopsis thaliana
GN=hsp88.1 PE=3 SV=1
Length = 768

Score = 324 bits (830), Expect = 3e-87
Identities = 160/219 (73%), Positives = 183/219 (83%)
Frame = +1

Query: 1 VEFRSLLYIPGMAPFNAEELYTANNKNIRLYVKRVFISADFDGELLPRYLGFVKGVVDSN 180
VEFRS+LYIPGM P N E++ KNIRLYVKRVFIS FDGEL PRYL FVKGVVDS+
Sbjct: 362 VEFRSILYIPGMGPLNNEDVTNPKTKNIRLYVKRVFISDHFDGELFPRYLSFVKGVVDSD 421

Query: 181 DLPLNVSREILQESRIVRIMKKRLVRKIFDMCQEIADREDKEAYKSFWTNFGRSIKLGCI 360
DLPLNVSREILQE RIVRIM+KRL+RK FDM QEI++ E+KE YK FW NFGR +KLGCI
Sbjct: 422 DLPLNVSREILQERRIVRIMRKRLIRKTFDMIQEISESENKEDYKKFWENFGRFLKLGCI 481

Query: 361 EDSANHKRLTPLLRFFTSKHEDSLVSLKTYVEDMKPEQNAIYYFAADSIKSAKSAPFLEA 540
ED+ NHKR+TPLLRFF+SK+E+ L SL Y+E+M Q AIYY A DS+KSAKSAPFLE
Sbjct: 482 EDTGNHKRITPLLRFFSSKNEEELTSLDDYIENMGENQKAIYYLATDSLKSAKSAPFLEK 541

Query: 541 LLKKDYEVLFLIEPIDEVAITNLQEYEGKKFVDISKEDL 657
L++KD EVL+L+EPIDEVAI NLQ Y+ KKFVDISKEDL
Sbjct: 542 LIQKDIEVLYLVEPIDEVAIQNLQTYKEKKFVDISKEDL 580