DK960458
Clone id TST39A01NGRL0007_H16
Library
Length 617
Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0007_H16. 5' end sequence.
Accession
Tissue type prothallia with plantlets
Developmental stage gametophytes with sporophytes
Contig ID
Sequence
CAACGAGAAAGGCTGCGCGCTGAAACCCTTCCGAGGAGTTCTGCTACCTTCTACCTTGAA
CTGGAGCCATGAGCGTTGCTCCGGGTATCGTTGAGCGCAATGGTCATCTCGACGCGCACA
TCGCTCAGCTCATGCAATGCAAGCCTCTGCTGGAGCCCGAGGTCAGATCTTTGTGTGAGA
AAGCCAAAGAAATTTTGATGGAGGAAAATAATGTTCAGCCGGTCAAATGTCCAGTCACAA
TTTGCGGTGATATTCACGGGCAATTTCACGATCTTGCCGAGCTTTTTCGGATTGGTGGGA
AGTGTCCGGATACAAACTATCTATTCATGGGAGATTATGTGGATCGTGGATACTACTCGG
TCGAAACTGCTACTCTTCTGGTGGCTTTGAAGGTTAGATATCCTGATAGAATCACAATTC
TCAGAGGCAATCATGAAAGTCGTCAGATTACACAAGTGTATGGCTTTTACGATGAATGCC
TCAGGAAGTACGGTAATGCGAATGTCTGGAAGATTTTCACGGATCTTTTTGACTATNTTC
CTCTAACTGCTTTAGTTGAGTCCGAGATATTTTGTCTGCATGGTGGTTTGTCACCTTCTA
TAGATACTCTCGATCAT
■■Homology search results ■■ -
sp_hit_id Q9XGH7
Definition sp|Q9XGH7|PP2A_TOBAC Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Nicotiana tabacum
Align length 173
Score (bit) 330.0
E-value 4.0e-90
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960458|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0007_H16, 5'
(617 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9XGH7|PP2A_TOBAC Serine/threonine-protein phosphatase PP2A c... 330 4e-90
sp|Q10BT5|PP2A2_ORYSJ Serine/threonine-protein phosphatase PP2A-... 328 1e-89
sp|A2XN40|PP2A2_ORYSI Serine/threonine-protein phosphatase PP2A-... 328 1e-89
sp|O04860|PP2A5_TOBAC Serine/threonine-protein phosphatase PP2A-... 326 5e-89
sp|A3C4N5|PP2A4_ORYSJ Serine/threonine-protein phosphatase PP2A-... 326 5e-89
sp|P48578|PP2A3_ARATH Serine/threonine-protein phosphatase PP2A-... 324 2e-88
sp|P0C5D7|PP2A4_ORYSI Putative serine/threonine-protein phosphat... 323 4e-88
sp|Q07100|PP2A4_ARATH Serine/threonine-protein phosphatase PP2A-... 322 7e-88
sp|P23778|PP2A_BRANA Serine/threonine-protein phosphatase PP2A c... 320 4e-87
sp|Q06009|PP2A_MEDSA Serine/threonine-protein phosphatase PP2A c... 319 8e-87
sp|Q07098|PP2A2_ARATH Serine/threonine-protein phosphatase PP2A-... 308 2e-83
sp|P48463|PP2AA_CHICK Serine/threonine-protein phosphatase 2A ca... 307 3e-83
sp|P48580|PP2A1_NEUCR Serine/threonine-protein phosphatase PP2A ... 306 4e-83
sp|P62716|PP2AB_RAT Serine/threonine-protein phosphatase 2A cata... 306 7e-83
sp|P11611|PP2AB_RABIT Serine/threonine-protein phosphatase 2A ca... 306 7e-83
sp|P62715|PP2AB_MOUSE Serine/threonine-protein phosphatase 2A ca... 306 7e-83
sp|P62714|PP2AB_HUMAN Serine/threonine-protein phosphatase 2A ca... 306 7e-83
sp|Q0P594|PP2AB_BOVIN Serine/threonine-protein phosphatase 2A ca... 306 7e-83
sp|Q07099|PP2A1_ARATH Serine/threonine-protein phosphatase PP2A-... 306 7e-83
sp|Q0E2S4|PP2A3_ORYSJ Serine/threonine-protein phosphatase PP2A-... 305 1e-82
sp|A2X2G3|PP2A3_ORYSI Serine/threonine-protein phosphatase PP2A-... 305 1e-82
sp|P63331|PP2AA_RAT Serine/threonine-protein phosphatase 2A cata... 303 4e-82
sp|P67777|PP2AA_RABIT Serine/threonine-protein phosphatase 2A ca... 303 4e-82
sp|P67776|PP2AA_PIG Serine/threonine-protein phosphatase 2A cata... 303 4e-82
sp|P63330|PP2AA_MOUSE Serine/threonine-protein phosphatase 2A ca... 303 4e-82
sp|P67775|PP2AA_HUMAN Serine/threonine-protein phosphatase 2A ca... 303 4e-82
sp|P67774|PP2AA_BOVIN Serine/threonine-protein phosphatase 2A ca... 303 4e-82
sp|Q9HFQ2|PP2A1_EMENI Serine/threonine-protein phosphatase PP2A ... 302 1e-81
sp|O04951|PP2A5_ARATH Serine/threonine-protein phosphatase PP2A-... 301 2e-81
sp|Q0DBD3|PP2A1_ORYSJ Serine/threonine-protein phosphatase PP2A-... 301 2e-81

>sp|Q9XGH7|PP2A_TOBAC Serine/threonine-protein phosphatase PP2A
catalytic subunit OS=Nicotiana tabacum PE=2 SV=1
Length = 312

Score = 330 bits (846), Expect = 4e-90
Identities = 158/173 (91%), Positives = 163/173 (94%)
Frame = +3

Query: 99 NGHLDAHIAQLMQCKPLLEPEVRSLCEKAKEILMEENNVQPVKCPVTICGDIHGQFHDLA 278
+G+LD IAQLMQCKPL E EVR LCEKAKEILMEE+NVQPVK PVTICGDIHGQFHDLA
Sbjct: 10 HGNLDEQIAQLMQCKPLSEQEVRGLCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLA 69

Query: 279 ELFRIGGKCPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRGNHESRQITQV 458
ELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLVALKVRYP RITILRGNHESRQITQV
Sbjct: 70 ELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQV 129

Query: 459 YGFYDECLRKYGNANVWKIFTDLFDYXPLTALVESEIFCLHGGLSPSIDTLDH 617
YGFYDECLRKYGNANVWK FTDLFDY PLTALVESEIFCLHGGLSPSI+TLD+
Sbjct: 130 YGFYDECLRKYGNANVWKTFTDLFDYFPLTALVESEIFCLHGGLSPSIETLDN 182


>sp|Q10BT5|PP2A2_ORYSJ Serine/threonine-protein phosphatase PP2A-2
catalytic subunit OS=Oryza sativa subsp. japonica
GN=PP2A2 PE=2 SV=1
Length = 307

Score = 328 bits (841), Expect = 1e-89
Identities = 157/173 (90%), Positives = 163/173 (94%)
Frame = +3

Query: 99 NGHLDAHIAQLMQCKPLLEPEVRSLCEKAKEILMEENNVQPVKCPVTICGDIHGQFHDLA 278
+G LD I +LMQCKPL EPEVR+LCEKAKEILMEE+NVQPVK PVTICGDIHGQFHDLA
Sbjct: 5 HGGLDDQIERLMQCKPLPEPEVRALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLA 64

Query: 279 ELFRIGGKCPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRGNHESRQITQV 458
ELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLVALKVRYP RITILRGNHESRQITQV
Sbjct: 65 ELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQV 124

Query: 459 YGFYDECLRKYGNANVWKIFTDLFDYXPLTALVESEIFCLHGGLSPSIDTLDH 617
YGFYDECLRKYGNANVWK FTDLFDY PLTALVESEIFCLHGGLSPSI+TLD+
Sbjct: 125 YGFYDECLRKYGNANVWKTFTDLFDYFPLTALVESEIFCLHGGLSPSIETLDN 177


>sp|A2XN40|PP2A2_ORYSI Serine/threonine-protein phosphatase PP2A-2
catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A2
PE=2 SV=2
Length = 307

Score = 328 bits (841), Expect = 1e-89
Identities = 157/173 (90%), Positives = 163/173 (94%)
Frame = +3

Query: 99 NGHLDAHIAQLMQCKPLLEPEVRSLCEKAKEILMEENNVQPVKCPVTICGDIHGQFHDLA 278
+G LD I +LMQCKPL EPEVR+LCEKAKEILMEE+NVQPVK PVTICGDIHGQFHDLA
Sbjct: 5 HGGLDDQIERLMQCKPLPEPEVRALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLA 64

Query: 279 ELFRIGGKCPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRGNHESRQITQV 458
ELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLVALKVRYP RITILRGNHESRQITQV
Sbjct: 65 ELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQV 124

Query: 459 YGFYDECLRKYGNANVWKIFTDLFDYXPLTALVESEIFCLHGGLSPSIDTLDH 617
YGFYDECLRKYGNANVWK FTDLFDY PLTALVESEIFCLHGGLSPSI+TLD+
Sbjct: 125 YGFYDECLRKYGNANVWKTFTDLFDYFPLTALVESEIFCLHGGLSPSIETLDN 177


>sp|O04860|PP2A5_TOBAC Serine/threonine-protein phosphatase PP2A-5
catalytic subunit OS=Nicotiana tabacum GN=NPP5 PE=2 SV=1
Length = 314

Score = 326 bits (836), Expect = 5e-89
Identities = 154/172 (89%), Positives = 163/172 (94%)
Frame = +3

Query: 102 GHLDAHIAQLMQCKPLLEPEVRSLCEKAKEILMEENNVQPVKCPVTICGDIHGQFHDLAE 281
G+LD I+QLMQCKPL EP+VR+LCEKAKEIL EE+NVQPVK PVTICGDIHGQFHDLAE
Sbjct: 13 GNLDEQISQLMQCKPLSEPDVRALCEKAKEILAEESNVQPVKSPVTICGDIHGQFHDLAE 72

Query: 282 LFRIGGKCPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRGNHESRQITQVY 461
LFRIGG+CPDTNYLFMGDYVDRGYYSVET TLLVALKVRYP R+TILRGNHESRQITQVY
Sbjct: 73 LFRIGGQCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRLTILRGNHESRQITQVY 132

Query: 462 GFYDECLRKYGNANVWKIFTDLFDYXPLTALVESEIFCLHGGLSPSIDTLDH 617
GFYDECLRKYGNANVWK FTDLFDY PLTALVESEIFCLHGGLSPSI+TLD+
Sbjct: 133 GFYDECLRKYGNANVWKTFTDLFDYFPLTALVESEIFCLHGGLSPSIETLDN 184


>sp|A3C4N5|PP2A4_ORYSJ Serine/threonine-protein phosphatase PP2A-4
catalytic subunit OS=Oryza sativa subsp. japonica
GN=PP2A4 PE=2 SV=2
Length = 314

Score = 326 bits (836), Expect = 5e-89
Identities = 155/171 (90%), Positives = 161/171 (94%)
Frame = +3

Query: 102 GHLDAHIAQLMQCKPLLEPEVRSLCEKAKEILMEENNVQPVKCPVTICGDIHGQFHDLAE 281
G LDA I QLM+C+PL EPEV++LCEKAKEILMEE+NVQPVK PVTICGDIHGQFHDL E
Sbjct: 13 GGLDAQIEQLMECRPLSEPEVKTLCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLVE 72

Query: 282 LFRIGGKCPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRGNHESRQITQVY 461
LFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLVALKVRYP RITILRGNHESRQITQVY
Sbjct: 73 LFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQVY 132

Query: 462 GFYDECLRKYGNANVWKIFTDLFDYXPLTALVESEIFCLHGGLSPSIDTLD 614
GFYDECLRKYG+ANVWKIFTDLFDY PLTALVESEIFCLHGGLSPSID LD
Sbjct: 133 GFYDECLRKYGSANVWKIFTDLFDYFPLTALVESEIFCLHGGLSPSIDNLD 183


>sp|P48578|PP2A3_ARATH Serine/threonine-protein phosphatase PP2A-3
catalytic subunit OS=Arabidopsis thaliana GN=PP2A3 PE=2
SV=1
Length = 313

Score = 324 bits (831), Expect = 2e-88
Identities = 154/170 (90%), Positives = 161/170 (94%)
Frame = +3

Query: 108 LDAHIAQLMQCKPLLEPEVRSLCEKAKEILMEENNVQPVKCPVTICGDIHGQFHDLAELF 287
LD I+QLMQCKPL E +VR+LCEKAKEILM+E+NVQPVK PVTICGDIHGQFHDLAELF
Sbjct: 14 LDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAELF 73

Query: 288 RIGGKCPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRGNHESRQITQVYGF 467
RIGGKCPDTNYLFMGDYVDRGYYSVET TLLV LKVRYP RITILRGNHESRQITQVYGF
Sbjct: 74 RIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVGLKVRYPQRITILRGNHESRQITQVYGF 133

Query: 468 YDECLRKYGNANVWKIFTDLFDYXPLTALVESEIFCLHGGLSPSIDTLDH 617
YDECLRKYGNANVWKIFTDLFDY PLTALVESEIFCLHGGLSPSI+TLD+
Sbjct: 134 YDECLRKYGNANVWKIFTDLFDYFPLTALVESEIFCLHGGLSPSIETLDN 183


>sp|P0C5D7|PP2A4_ORYSI Putative serine/threonine-protein phosphatase
PP2A-4 catalytic subunit OS=Oryza sativa subsp. indica
GN=PP2A4 PE=3 SV=1
Length = 315

Score = 323 bits (828), Expect = 4e-88
Identities = 154/171 (90%), Positives = 160/171 (93%)
Frame = +3

Query: 102 GHLDAHIAQLMQCKPLLEPEVRSLCEKAKEILMEENNVQPVKCPVTICGDIHGQFHDLAE 281
G LDA I QLM+C+PL E EV++LCEKAKEILMEE+NVQPVK PVTICGDIHGQFHDL E
Sbjct: 14 GGLDAQIEQLMECRPLSETEVKTLCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLVE 73

Query: 282 LFRIGGKCPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRGNHESRQITQVY 461
LFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLVALKVRYP RITILRGNHESRQITQVY
Sbjct: 74 LFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQVY 133

Query: 462 GFYDECLRKYGNANVWKIFTDLFDYXPLTALVESEIFCLHGGLSPSIDTLD 614
GFYDECLRKYG+ANVWKIFTDLFDY PLTALVESEIFCLHGGLSPSID LD
Sbjct: 134 GFYDECLRKYGSANVWKIFTDLFDYFPLTALVESEIFCLHGGLSPSIDNLD 184


>sp|Q07100|PP2A4_ARATH Serine/threonine-protein phosphatase PP2A-4
catalytic subunit OS=Arabidopsis thaliana GN=PP2A4 PE=2
SV=2
Length = 313

Score = 322 bits (826), Expect = 7e-88
Identities = 153/170 (90%), Positives = 161/170 (94%)
Frame = +3

Query: 108 LDAHIAQLMQCKPLLEPEVRSLCEKAKEILMEENNVQPVKCPVTICGDIHGQFHDLAELF 287
LD I+QLMQCKPL E +VR+LCEKAKEILM+E+NVQPVK PVTICGDIHGQFHDLAELF
Sbjct: 14 LDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAELF 73

Query: 288 RIGGKCPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRGNHESRQITQVYGF 467
RIGG CPDTNYLFMGDYVDRGYYSVET TLLVALK+RYP RITILRGNHESRQITQVYGF
Sbjct: 74 RIGGMCPDTNYLFMGDYVDRGYYSVETVTLLVALKMRYPQRITILRGNHESRQITQVYGF 133

Query: 468 YDECLRKYGNANVWKIFTDLFDYXPLTALVESEIFCLHGGLSPSIDTLDH 617
YDECLRKYGNANVWKIFTDLFDY PLTALVESEIFCLHGGLSPSI+TLD+
Sbjct: 134 YDECLRKYGNANVWKIFTDLFDYFPLTALVESEIFCLHGGLSPSIETLDN 183


>sp|P23778|PP2A_BRANA Serine/threonine-protein phosphatase PP2A
catalytic subunit (Fragment) OS=Brassica napus PE=2 SV=2
Length = 309

Score = 320 bits (820), Expect = 4e-87
Identities = 152/170 (89%), Positives = 159/170 (93%)
Frame = +3

Query: 108 LDAHIAQLMQCKPLLEPEVRSLCEKAKEILMEENNVQPVKCPVTICGDIHGQFHDLAELF 287
LD I+QLMQCKPL E +VR+LCEKAKEILM+E+NVQPVK PVTICGDIHGQFHDLAELF
Sbjct: 10 LDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAELF 69

Query: 288 RIGGKCPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRGNHESRQITQVYGF 467
RIGG CPDTNYLFMGDYVDRGYYSVET TLLV LKVRYP RITILRGNHESRQITQVYGF
Sbjct: 70 RIGGMCPDTNYLFMGDYVDRGYYSVETVTLLVGLKVRYPQRITILRGNHESRQITQVYGF 129

Query: 468 YDECLRKYGNANVWKIFTDLFDYXPLTALVESEIFCLHGGLSPSIDTLDH 617
YDECLRKYGNANVWK FTDLFDY PLTALVESEIFCLHGGLSPSI+TLD+
Sbjct: 130 YDECLRKYGNANVWKYFTDLFDYLPLTALVESEIFCLHGGLSPSIETLDN 179


>sp|Q06009|PP2A_MEDSA Serine/threonine-protein phosphatase PP2A
catalytic subunit OS=Medicago sativa GN=PP2A PE=2 SV=1
Length = 313

Score = 319 bits (817), Expect = 8e-87
Identities = 151/170 (88%), Positives = 161/170 (94%)
Frame = +3

Query: 108 LDAHIAQLMQCKPLLEPEVRSLCEKAKEILMEENNVQPVKCPVTICGDIHGQFHDLAELF 287
L+ I+QLMQCKPL E +V+ LCEKAKEILM+E+NVQPVK PVTICGDIHGQFHDLAELF
Sbjct: 14 LNEQISQLMQCKPLSEQQVKELCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAELF 73

Query: 288 RIGGKCPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRGNHESRQITQVYGF 467
RIGGKCPDTNYLFMGDYVDRGYYSVET TLLVALKVRYP RITILRGNHESRQITQVYGF
Sbjct: 74 RIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQVYGF 133

Query: 468 YDECLRKYGNANVWKIFTDLFDYXPLTALVESEIFCLHGGLSPSIDTLDH 617
YDECLRKYG+ANVWKIFTDLFD+ PLTALVESEIFCLHGGLSPSI+TLD+
Sbjct: 134 YDECLRKYGSANVWKIFTDLFDFFPLTALVESEIFCLHGGLSPSIETLDN 183


tr_hit_id A9SI18
Definition tr|A9SI18|A9SI18_PHYPA Serine/threonine protein phosphatase OS=Physcomitrella patens subsp. patens
Align length 183
Score (bit) 343.0
E-value 5.0e-93
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= DK960458|Adiantum capillus-veneris mRNA, clone:
TST39A01NGRL0007_H16, 5'
(617 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SI18|A9SI18_PHYPA Serine/threonine protein phosphatase OS=P... 343 5e-93
tr|A9SKN9|A9SKN9_PHYPA Serine/threonine protein phosphatase OS=P... 341 2e-92
tr|A9SKN8|A9SKN8_PHYPA Serine/threonine protein phosphatase OS=P... 340 5e-92
tr|A9NVN6|A9NVN6_PICSI Serine/threonine protein phosphatase OS=P... 335 1e-90
tr|A7QR82|A7QR82_VITVI Serine/threonine protein phosphatase OS=V... 333 4e-90
tr|A5AT05|A5AT05_VITVI Serine/threonine protein phosphatase OS=V... 330 3e-89
tr|B6T4R7|B6T4R7_MAIZE PP2Ac-2-Phosphatase 2A isoform 2 belongin... 329 9e-89
tr|B7E5E8|B7E5E8_ORYSJ cDNA clone:001-035-B04, full insert seque... 328 2e-88
tr|B6TNR3|B6TNR3_MAIZE PP2Ac-2-Phosphatase 2A isoform 2 belongin... 328 2e-88
tr|B4G1M9|B4G1M9_MAIZE Putative uncharacterized protein OS=Zea m... 328 2e-88
tr|B7EPC1|B7EPC1_ORYSJ cDNA clone:J013047L01, full insert sequen... 326 6e-88
tr|B4F7Y0|B4F7Y0_MAIZE Putative uncharacterized protein OS=Zea m... 322 8e-87
tr|B6TCD1|B6TCD1_MAIZE PP2Ac-5-Phosphatase 2A isoform 5 belongin... 322 1e-86
tr|B6TBU7|B6TBU7_MAIZE PP2Ac-5-Phosphatase 2A isoform 5 belongin... 322 1e-86
tr|Q10R90|Q10R90_ORYSJ Serine/threonine protein phosphatase OS=O... 321 2e-86
tr|B6TM48|B6TM48_MAIZE PP2Ac-4-Phosphatase 2A isoform 4 belongin... 321 2e-86
tr|Q5KGH3|Q5KGH3_CRYNE Serine/threonine protein phosphatase OS=C... 321 2e-86
tr|Q55S21|Q55S21_CRYNE Serine/threonine protein phosphatase OS=C... 321 2e-86
tr|Q9MB04|Q9MB04_VICFA Serine/threonine protein phosphatase OS=V... 321 2e-86
tr|A5H7F0|A5H7F0_WHEAT Serine/threonine protein phosphatase OS=T... 320 4e-86
tr|O81956|O81956_CATRO Serine/threonine protein phosphatase OS=C... 318 2e-85
tr|A9NNZ2|A9NNZ2_PICSI Serine/threonine protein phosphatase OS=P... 311 2e-83
tr|Q9XZE5|Q9XZE5_DICDI Serine/threonine protein phosphatase OS=D... 309 1e-82
tr|A8P430|A8P430_COPC7 Serine/threonine protein phosphatase OS=C... 308 2e-82
tr|B5G4N9|B5G4N9_TAEGU Putative phosphatase 2A lytic subunit (Fr... 307 4e-82
tr|Q8S7U0|Q8S7U0_ORYSJ Serine/threonine protein phosphatase OS=O... 307 4e-82
tr|B8APA0|B8APA0_ORYSI Putative uncharacterized protein OS=Oryza... 307 4e-82
tr|B8PPX8|B8PPX8_9APHY Serine/threonine protein phosphatase 2A O... 307 4e-82
tr|B8PAD2|B8PAD2_9APHY Serine threonine protein phosphatase 2A O... 307 4e-82
tr|Q803G3|Q803G3_DANRE Serine/threonine protein phosphatase OS=D... 306 5e-82

>tr|A9SI18|A9SI18_PHYPA Serine/threonine protein phosphatase
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_109960 PE=3 SV=1
Length = 311

Score = 343 bits (880), Expect = 5e-93
Identities = 166/183 (90%), Positives = 169/183 (92%)
Frame = +3

Query: 69 MSVAPGIVERNGHLDAHIAQLMQCKPLLEPEVRSLCEKAKEILMEENNVQPVKCPVTICG 248
MSV P + NG LD IAQL+QCKPL E EVR LCEKAKEILM ENNVQPVKCPVTICG
Sbjct: 1 MSVPP--ISSNGQLDTQIAQLIQCKPLSEVEVRGLCEKAKEILMRENNVQPVKCPVTICG 58

Query: 249 DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRG 428
DIHGQFHDLAELFRIGG CPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRG
Sbjct: 59 DIHGQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRG 118

Query: 429 NHESRQITQVYGFYDECLRKYGNANVWKIFTDLFDYXPLTALVESEIFCLHGGLSPSIDT 608
NHESRQITQVYGFYDECLRKYGNANVWKIFTDLFDY PLTALVESEIFCLHGGLSPSID+
Sbjct: 119 NHESRQITQVYGFYDECLRKYGNANVWKIFTDLFDYFPLTALVESEIFCLHGGLSPSIDS 178

Query: 609 LDH 617
LDH
Sbjct: 179 LDH 181


>tr|A9SKN9|A9SKN9_PHYPA Serine/threonine protein phosphatase
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_165450 PE=3 SV=1
Length = 301

Score = 341 bits (875), Expect = 2e-92
Identities = 163/176 (92%), Positives = 166/176 (94%)
Frame = +3

Query: 90 VERNGHLDAHIAQLMQCKPLLEPEVRSLCEKAKEILMEENNVQPVKCPVTICGDIHGQFH 269
V NG LDA IA+L+QCKPL E EVR LCEKAKEILM ENNVQPVKCPVTICGDIHGQFH
Sbjct: 6 VSSNGQLDAQIAELIQCKPLSELEVRGLCEKAKEILMRENNVQPVKCPVTICGDIHGQFH 65

Query: 270 DLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRGNHESRQI 449
DLAELFRIGG CPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRGNHESRQI
Sbjct: 66 DLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRGNHESRQI 125

Query: 450 TQVYGFYDECLRKYGNANVWKIFTDLFDYXPLTALVESEIFCLHGGLSPSIDTLDH 617
TQVYGFYDECLRKYGNANVWKIFTDLFDY PLTALVESEIFCLHGGLSPSID+LDH
Sbjct: 126 TQVYGFYDECLRKYGNANVWKIFTDLFDYFPLTALVESEIFCLHGGLSPSIDSLDH 181


>tr|A9SKN8|A9SKN8_PHYPA Serine/threonine protein phosphatase
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_165449 PE=3 SV=1
Length = 313

Score = 340 bits (871), Expect = 5e-92
Identities = 165/183 (90%), Positives = 170/183 (92%)
Frame = +3

Query: 69 MSVAPGIVERNGHLDAHIAQLMQCKPLLEPEVRSLCEKAKEILMEENNVQPVKCPVTICG 248
MSV P +G LDA IAQL+QCKPL E EVR+LCEKAKEILMEENNVQPVKCPVTICG
Sbjct: 1 MSVPPVSSNVHGQLDAQIAQLIQCKPLPELEVRALCEKAKEILMEENNVQPVKCPVTICG 60

Query: 249 DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRG 428
DIHGQFHDLAELFRIGG CPDTNYLFMGDYVDRGYYSVETATLLVALKVR+ DRITILRG
Sbjct: 61 DIHGQFHDLAELFRIGGMCPDTNYLFMGDYVDRGYYSVETATLLVALKVRHQDRITILRG 120

Query: 429 NHESRQITQVYGFYDECLRKYGNANVWKIFTDLFDYXPLTALVESEIFCLHGGLSPSIDT 608
NHESRQITQVYGFYDECLRKYGNANVWKIFTDLFDY PLTALVESEIFCLHGGLSPSID+
Sbjct: 121 NHESRQITQVYGFYDECLRKYGNANVWKIFTDLFDYFPLTALVESEIFCLHGGLSPSIDS 180

Query: 609 LDH 617
LDH
Sbjct: 181 LDH 183


>tr|A9NVN6|A9NVN6_PICSI Serine/threonine protein phosphatase
OS=Picea sitchensis PE=2 SV=1
Length = 314

Score = 335 bits (860), Expect = 1e-90
Identities = 160/172 (93%), Positives = 163/172 (94%)
Frame = +3

Query: 102 GHLDAHIAQLMQCKPLLEPEVRSLCEKAKEILMEENNVQPVKCPVTICGDIHGQFHDLAE 281
G LDA I QLMQCKPL E EVR LCEKAKEILMEE+NVQPVKCPVTICGDIHGQFHDLAE
Sbjct: 13 GQLDAQIEQLMQCKPLSEQEVRGLCEKAKEILMEESNVQPVKCPVTICGDIHGQFHDLAE 72

Query: 282 LFRIGGKCPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRGNHESRQITQVY 461
LFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV+LKVRYP RITILRGNHESRQITQVY
Sbjct: 73 LFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVSLKVRYPQRITILRGNHESRQITQVY 132

Query: 462 GFYDECLRKYGNANVWKIFTDLFDYXPLTALVESEIFCLHGGLSPSIDTLDH 617
GFYDECLRKYGNANVWKIFTDLFDY PLTALVESEIFCLHGGLSPSIDTLD+
Sbjct: 133 GFYDECLRKYGNANVWKIFTDLFDYFPLTALVESEIFCLHGGLSPSIDTLDN 184


>tr|A7QR82|A7QR82_VITVI Serine/threonine protein phosphatase
OS=Vitis vinifera GN=GSVIVT00003715001 PE=3 SV=1
Length = 313

Score = 333 bits (855), Expect = 4e-90
Identities = 159/175 (90%), Positives = 167/175 (95%)
Frame = +3

Query: 93 ERNGHLDAHIAQLMQCKPLLEPEVRSLCEKAKEILMEENNVQPVKCPVTICGDIHGQFHD 272
+ +G+LDA I+QLMQCKPL E EVR+LCEKAKEILMEE+NVQPVK PVTICGDIHGQFHD
Sbjct: 9 DSHGNLDAQISQLMQCKPLSEQEVRTLCEKAKEILMEESNVQPVKSPVTICGDIHGQFHD 68

Query: 273 LAELFRIGGKCPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRGNHESRQIT 452
LAELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLVALKVRYP RITILRGNHESRQIT
Sbjct: 69 LAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQIT 128

Query: 453 QVYGFYDECLRKYGNANVWKIFTDLFDYXPLTALVESEIFCLHGGLSPSIDTLDH 617
QVYGFYDECLRKYGNANVWKIFTDLFDY PLTALVESEIFCLHGGLSPSI+TLD+
Sbjct: 129 QVYGFYDECLRKYGNANVWKIFTDLFDYFPLTALVESEIFCLHGGLSPSIETLDN 183


>tr|A5AT05|A5AT05_VITVI Serine/threonine protein phosphatase
OS=Vitis vinifera GN=GSVIVT00024763001 PE=3 SV=1
Length = 314

Score = 330 bits (847), Expect = 3e-89
Identities = 158/173 (91%), Positives = 164/173 (94%)
Frame = +3

Query: 99 NGHLDAHIAQLMQCKPLLEPEVRSLCEKAKEILMEENNVQPVKCPVTICGDIHGQFHDLA 278
+G+LD I+QLMQCKPL E EVR LCEKAKEILMEE+NVQPVK PVTICGDIHGQFHDLA
Sbjct: 12 HGNLDEQISQLMQCKPLSEQEVRMLCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLA 71

Query: 279 ELFRIGGKCPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRGNHESRQITQV 458
ELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLVALKVRYP RITILRGNHESRQITQV
Sbjct: 72 ELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQV 131

Query: 459 YGFYDECLRKYGNANVWKIFTDLFDYXPLTALVESEIFCLHGGLSPSIDTLDH 617
YGFYDECLRKYGNANVWKIFTDLFDY PLTALVESEIFCLHGGLSPSI+TLD+
Sbjct: 132 YGFYDECLRKYGNANVWKIFTDLFDYFPLTALVESEIFCLHGGLSPSIETLDN 184


>tr|B6T4R7|B6T4R7_MAIZE PP2Ac-2-Phosphatase 2A isoform 2 belonging
to family 2 OS=Zea mays PE=2 SV=1
Length = 307

Score = 329 bits (843), Expect = 9e-89
Identities = 157/173 (90%), Positives = 163/173 (94%)
Frame = +3

Query: 99 NGHLDAHIAQLMQCKPLLEPEVRSLCEKAKEILMEENNVQPVKCPVTICGDIHGQFHDLA 278
+G LD I +LMQCKPL EPEVR+LCEKAKEILMEE+NVQPVK PVTICGDIHGQFHDLA
Sbjct: 5 HGGLDDQIERLMQCKPLAEPEVRALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLA 64

Query: 279 ELFRIGGKCPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRGNHESRQITQV 458
ELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLVALKVRYP RITILRGNHESRQITQV
Sbjct: 65 ELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQV 124

Query: 459 YGFYDECLRKYGNANVWKIFTDLFDYXPLTALVESEIFCLHGGLSPSIDTLDH 617
YGFYDECLRKYGNANVWK FTDLFDY PLTALVESEIFCLHGGLSPSI+TLD+
Sbjct: 125 YGFYDECLRKYGNANVWKTFTDLFDYFPLTALVESEIFCLHGGLSPSIETLDN 177


>tr|B7E5E8|B7E5E8_ORYSJ cDNA clone:001-035-B04, full insert sequence
OS=Oryza sativa subsp. japonica PE=2 SV=1
Length = 307

Score = 328 bits (841), Expect = 2e-88
Identities = 157/173 (90%), Positives = 163/173 (94%)
Frame = +3

Query: 99 NGHLDAHIAQLMQCKPLLEPEVRSLCEKAKEILMEENNVQPVKCPVTICGDIHGQFHDLA 278
+G LD I +LMQCKPL EPEVR+LCEKAKEILMEE+NVQPVK PVTICGDIHGQFHDLA
Sbjct: 5 HGGLDDQIERLMQCKPLPEPEVRALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLA 64

Query: 279 ELFRIGGKCPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRGNHESRQITQV 458
ELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLVALKVRYP RITILRGNHESRQITQV
Sbjct: 65 ELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQV 124

Query: 459 YGFYDECLRKYGNANVWKIFTDLFDYXPLTALVESEIFCLHGGLSPSIDTLDH 617
YGFYDECLRKYGNANVWK FTDLFDY PLTALVESEIFCLHGGLSPSI+TLD+
Sbjct: 125 YGFYDECLRKYGNANVWKTFTDLFDYFPLTALVESEIFCLHGGLSPSIETLDN 177


>tr|B6TNR3|B6TNR3_MAIZE PP2Ac-2-Phosphatase 2A isoform 2 belonging
to family 2 OS=Zea mays PE=2 SV=1
Length = 307

Score = 328 bits (840), Expect = 2e-88
Identities = 156/173 (90%), Positives = 163/173 (94%)
Frame = +3

Query: 99 NGHLDAHIAQLMQCKPLLEPEVRSLCEKAKEILMEENNVQPVKCPVTICGDIHGQFHDLA 278
+G LD I +LMQCKPL EPEVR+LCEKAK+ILMEE+NVQPVK PVTICGDIHGQFHDLA
Sbjct: 5 HGGLDDQIERLMQCKPLAEPEVRALCEKAKDILMEESNVQPVKSPVTICGDIHGQFHDLA 64

Query: 279 ELFRIGGKCPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRGNHESRQITQV 458
ELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLVALKVRYP RITILRGNHESRQITQV
Sbjct: 65 ELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQV 124

Query: 459 YGFYDECLRKYGNANVWKIFTDLFDYXPLTALVESEIFCLHGGLSPSIDTLDH 617
YGFYDECLRKYGNANVWK FTDLFDY PLTALVESEIFCLHGGLSPSI+TLD+
Sbjct: 125 YGFYDECLRKYGNANVWKTFTDLFDYFPLTALVESEIFCLHGGLSPSIETLDN 177


>tr|B4G1M9|B4G1M9_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 307

Score = 328 bits (840), Expect = 2e-88
Identities = 156/173 (90%), Positives = 163/173 (94%)
Frame = +3

Query: 99 NGHLDAHIAQLMQCKPLLEPEVRSLCEKAKEILMEENNVQPVKCPVTICGDIHGQFHDLA 278
+G LD I +LMQCKPL EPEVR+LCEKAKEILMEE+NVQPVK PVTICGDIHGQFHDLA
Sbjct: 5 HGGLDDQIERLMQCKPLAEPEVRALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLA 64

Query: 279 ELFRIGGKCPDTNYLFMGDYVDRGYYSVETATLLVALKVRYPDRITILRGNHESRQITQV 458
ELFRIGGKCPDTNYLFMGDYVDRGYYSVET TLLV+LKVRYP RITILRGNHESRQITQV
Sbjct: 65 ELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVSLKVRYPQRITILRGNHESRQITQV 124

Query: 459 YGFYDECLRKYGNANVWKIFTDLFDYXPLTALVESEIFCLHGGLSPSIDTLDH 617
YGFYDECLRKYGNANVWK FTDLFDY PLTALVESEIFCLHGGLSPSI+TLD+
Sbjct: 125 YGFYDECLRKYGNANVWKTFTDLFDYFPLTALVESEIFCLHGGLSPSIETLDN 177